KEGG   Bacillus coagulans 36D1: Bcoa_0700
Entry
Bcoa_0700         CDS       T01628                                 

Definition
(GenBank) tartrate dehydrogenase
  KO
K07246  tartrate dehydrogenase/decarboxylase / D-malate dehydrogenase [EC:1.1.1.93 4.1.1.73 1.1.1.83]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00630  Glyoxylate and dicarboxylate metabolism
bag00650  Butanoate metabolism
bag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bcoa_0700
   00650 Butanoate metabolism
    Bcoa_0700
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.83  D-malate dehydrogenase (decarboxylating)
     Bcoa_0700
    1.1.1.93  tartrate dehydrogenase
     Bcoa_0700
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.73  tartrate decarboxylase
     Bcoa_0700
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-ProteinID: AEO99919
UniProt: G2TQS1
LinkDB
Position
complement(748070..749128)
AA seq 352 aa
MKIYHIAAIPGDGIGKEVVPAAIRVLHAAAERHGGIRFEFTAFPWSCDDYLVQGKMMPDN
GLEILKDYEAIFLGAVGNPRLVPDHVSLWGLLLKIRRGFEQVLNIRPAKYFKGLQSPLRD
PKDFDFIVVRENSEGEYSEVGGRIHRGEDEIAIQNAIFTRKGTERAMRYAFELAQKRGRR
LTSATKSNGIFHTMPFWDEVFSQVKAGYPDVAVNSMHIDALSAFLVMKPETFDVIVASNL
FGDILTDIGGAIMGSIGIAPSANINLDGKYPSMFEPVHGSAPDIAGKGIANPIGQIWTAK
MMLDHFGETEMGEMIMDAIEWTIEKGIKTPDIGGTATTKEVTEAVCRRILQT
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaaaatataccatatcgcggcgatcccgggcgatgggattggaaaagaagtggtgccg
gctgccatccgtgtgctgcatgcggcagcggaacggcatggcggaatccggttcgaattc
acggcgttcccgtggagctgtgatgattatcttgttcagggaaaaatgatgccggataac
gggcttgagattttaaaagattatgaggctatttttctcggggcagtcggcaatccaagg
cttgtgccggatcatgtgtcgctttggggccttttgctaaaaatccggcgcggcttcgaa
caggtgctgaatatccggcctgcaaagtatttcaaagggctgcagtccccgttaagggac
ccgaaagattttgatttcattgtcgtgcgtgaaaacagcgaaggggagtacagcgaggtt
ggcggcagaattcatcgcggtgaagacgaaattgcgatccagaatgcaatttttacaaga
aaaggaacagagcgggcgatgcgatatgcgtttgaactggcgcaaaaacgcggccgacgc
ctgactagtgcaacgaaatcaaacggcattttccacacaatgcctttttgggacgaggtg
ttcagccaggtaaaggctggctatccggatgtagctgtaaacagcatgcatattgatgca
ctgtctgcttttctggtgatgaagccggagacgtttgatgtcattgttgcgagcaatttg
ttcggggatattttaacagatattggcggcgcgattatgggcagcatcggcattgcgccg
tccgcgaacatcaatttggacggaaaatatccttccatgtttgaacctgtccacggctcg
gcgccggatattgcaggaaaaggcattgccaacccaataggccaaatttggacagctaaa
atgatgctcgatcactttggcgaaacagaaatgggtgaaatgataatggatgcaatcgaa
tggacgattgaaaaaggcatcaaaaccccggacatcggcggaacggcaacaacaaaagaa
gtaacagaagcagtttgccggcgcattttacaaacttaa

DBGET integrated database retrieval system