KEGG   Bacillus coagulans 36D1: Bcoa_1002
Entry
Bcoa_1002         CDS       T01628                                 

Definition
(GenBank) succinic semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00250  Alanine, aspartate and glutamate metabolism
bag00310  Lysine degradation
bag00350  Tyrosine metabolism
bag00650  Butanoate metabolism
bag00760  Nicotinate and nicotinamide metabolism
bag01100  Metabolic pathways
bag01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcoa_1002
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcoa_1002
   00310 Lysine degradation
    Bcoa_1002
   00350 Tyrosine metabolism
    Bcoa_1002
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Bcoa_1002
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     Bcoa_1002
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     Bcoa_1002
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     Bcoa_1002
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AEP00220
UniProt: G2TRE4
LinkDB
Position
complement(1088954..1090372)
AA seq 472 aa
MEDYLMYLNGEWTGEGLPKIKVDNPASGEVIATIPKGGEKEAKLAVDAAHAAFPAWAALS
AYERSAYLRTWFELIRQHENELARTMTIEQGKPLKEALGEMRYANGFIEWFAEEGKRVYG
ETIPASATNKRLFVHKQPVGVVAAITPWNFPAAMITRKVAPALAAGCTVVIKPAKQTPLT
ALKLAELAAKAGIPKGVMNVITGSAKEIGDTWLADERVRKLTFTGSTEIGKELMRGSADT
VKKVSLELGGHAPVIITKHADLDKAAEGTVAAKFRNAGQTCVCSNRIYVQEEVYEAFTKK
FTEKVKALRVGDGLAEGTDIGPLIDRNAVEKVEHHVKDAVEKGATVETGGSAKDGLFFEP
TVISNVTDEMICMKEETFGPLAPVTKFTDIDEAIRRANDSIYGLAAYVFTENISEGIQIA
EGLEYGIVGLNDGLPSTPQAPFGGFKQSGLGREGGRYGIEEFLEVKYISLGL
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggaagactatttgatgtacttgaatggtgaatggacgggggaaggactgccaaaaatc
aaagtggacaaccctgcgtccggcgaagtgattgcgacgattccaaaaggcggggaaaag
gaagctaagctcgctgttgacgcggcgcatgcggcttttccggcgtgggcggcgctttct
gcctatgaacgaagtgcctacctccgcacgtggtttgaactgatccgtcaacatgaaaac
gagcttgccaggacgatgaccattgaacagggcaagccgctcaaggaagcactcggggaa
atgcgttacgcaaatggctttatcgagtggtttgccgaagaaggaaagcgtgtgtatggc
gaaacgattccggcatccgctaccaataaacgcctgtttgtccataaacagccggtcggc
gttgtcgcggcaattaccccgtggaatttcccggctgccatgattacccgcaaagttgca
cctgcgcttgctgccggctgcaccgttgtcatcaaaccggcaaagcagacaccgcttact
gccttgaagcttgctgagcttgctgcaaaagccggcattccgaaaggcgtcatgaatgtg
ataaccgggagtgcgaaggaaatcggggacacgtggcttgccgatgagcgtgtccgcaaa
cttacttttaccggatcgaccgaaatcgggaaagagctgatgcgcggttcagctgacacg
gtgaaaaaagtgtcgctggaacttggcgggcatgcaccggttatcatcacgaaacatgcg
gatctcgataaagctgctgagggcacggtcgctgcaaaattccgcaacgccggccagact
tgtgtatgctcgaaccgcatatatgtacaggaagaagtgtatgaagcttttaccaagaaa
ttcacagaaaaagtgaaagcgctccgtgtcggggacggacttgcagaaggcacggatatc
gggccgctgattgaccggaatgcggttgaaaaagtagaacatcacgtcaaagacgcggtg
gaaaagggagctaccgtggaaacaggcggcagcgcgaaagatgggcttttctttgaacca
actgtcatttccaatgttaccgatgagatgatatgcatgaaagaagaaacattcgggccg
cttgcaccggtaacgaaatttacggatattgatgaagcgatccggcgtgccaatgattcc
atttacggtcttgctgcgtatgtatttacggaaaatatttcggaaggcattcaaattgca
gaggggctggagtatggcattgtcgggctgaacgatgggcttccgtccacgccgcaggct
ccattcggcggtttcaagcagagcggcctcggcagggaaggcggccgttacggtatagaa
gaatttttggaagtcaaatatatttccctcggtttataa

DBGET integrated database retrieval system