KEGG   Bacillus coagulans 36D1: Bcoa_1061
Entry
Bcoa_1061         CDS       T01628                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00072  Synthesis and degradation of ketone bodies
bag00280  Valine, leucine and isoleucine degradation
bag00650  Butanoate metabolism
bag00900  Terpenoid backbone biosynthesis
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcoa_1061
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bcoa_1061
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcoa_1061
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcoa_1061
Enzymes [BR:bag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     Bcoa_1061
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III
Other DBs
NCBI-ProteinID: AEP00279
UniProt: G2THE0
LinkDB
Position
1152116..1153300
AA seq 394 aa
MQIGIDKIGFYTPHLYVDMEKLALARNEDPGKFLIGIGQEKMAVAPVTQDAVTLAANAAL
EILTDEDKEKIDFVIFGTESGVDHSKAAAIYVHRLLGLKPEVRAVEVKEACFGATAGLQM
ARGHIALHPESKVLVLGSDISRYGLNTSGEVTQGAGAVAMVVSAHPNILAIEEPSVYHTE
DIMDFWRPVYSDSAYVDGKFSNEKYISFFQNVWKQYREKTGFTLSDFKAICFHMPYTKMG
LKALRTVLDETDEDGRERLLAHYETSKSYNKIVGNIYTGALYLSLLSLLEQNTNIEAGAR
IGLYSYGSGAVGEFFSGILQPGYRKALQPARHQQMLEARKEISVAEYEAIFTTSLPNDGS
AVTLPVNEDPATVCLAGIEGHKRQYVNKNNRVGG
NT seq 1185 nt   +upstreamnt  +downstreamnt
ttgcaaatcggaatagacaagatcgggttttataccccgcatttatatgttgacatggaa
aaactggcacttgcccggaatgaggaccctggaaaatttttaatcggaatcggccaggaa
aaaatggccgtcgccccggtgacccaggacgcggtgacgctcgcagccaatgcggcgctc
gaaattttaacagacgaagataaagaaaaaattgatttcgttattttcggcacggaatcc
ggcgtcgaccactcgaaggcggccgcaatttatgtgcaccgcctgctcggcttaaaaccg
gaagtgcgggccgttgaagtgaaagaagcatgcttcggtgctacggcagggctgcaaatg
gcaagagggcatatcgccctgcatccggaaagcaaagtgctcgtgctcgggtcggatatt
tccagatacggattgaatacttcaggagaggtcacccaaggggcgggcgccgtcgccatg
gtcgtaagcgcccatccgaacatccttgcgatcgaagaaccgagcgtgtaccatacggaa
gacatcatggacttttggcggccggtctattcggattccgcttatgtggacggcaagttt
tccaatgaaaaatacatcagtttcttccaaaatgtctggaagcagtacagagaaaaaacc
ggctttacgctaagtgatttcaaagccatttgcttccatatgccgtatacaaaaatgggc
ttaaaagcgctgagaacggtgttggatgaaacggatgaagacgggcgcgaaagactcctg
gcccattatgaaacaagcaaaagttataacaaaatagtcgggaacatttataccggcgct
ttgtatttgagcctgctttccctgctcgaacaaaatacaaatatagaagcaggtgcgagg
atcggcctgtacagctacggttccggcgcagtcggggaatttttctcagggatcctgcag
ccgggctaccgtaaagccttgcagccggcccgccatcagcaaatgctcgaggcacgaaaa
gaaattagcgttgccgaatacgaagccatttttaccacatcgcttccaaacgacgggtcg
gccgttaccttgccggtgaacgaggatccggccaccgtttgccttgccggaatcgaaggg
cacaagcggcaatacgttaataaaaacaatcgagtaggaggctaa

DBGET integrated database retrieval system