KEGG   Bacillus coagulans 36D1: Bcoa_1422
Entry
Bcoa_1422         CDS       T01628                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain-containing protein
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00071  Fatty acid degradation
bag00280  Valine, leucine and isoleucine degradation
bag00410  beta-Alanine metabolism
bag00640  Propanoate metabolism
bag00650  Butanoate metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01200  Carbon metabolism
bag01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcoa_1422
   00650 Butanoate metabolism
    Bcoa_1422
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcoa_1422
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcoa_1422
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcoa_1422
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Bcoa_1422
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M HpaB_N
Other DBs
NCBI-ProteinID: AEP00628
UniProt: G2THR0
LinkDB
Position
1540572..1541714
AA seq 380 aa
MDFRLSEEHEMIRKMVRDFAVKEVAPTAAERDENERFDRGIFDQMAALGLTGIPWPEQYG
GIGSDFLAYCIAVEELSRVCASTGVTLSAHTSLASWPLFKFGTEEQKQKYLVPLARGEKI
GAYGLTEPGSGSDAGAMVTTARREGDHYVLNGSKIFITNGGVADIYIVFALTDPKSKHHG
TSAFIIEKDFPGFSTGKKEKKMGIRASTTTEIIFDNVIVPAENRLGEEGQGFKIAMMTLD
GGRNGIAAQAVGIAQGALDAATAYAKERKQFGKPIAANQGVSFKLADMATAVEAARLLTY
QAAWLESNGLPYGKESAMSKLFAGDTAMKVTTEAVQIFGGYGYTKDYPVERFMRDAKITQ
IYEGTQEIQRLVISRMLTRD
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggactttcgtttgagtgaagaacatgaaatgatccggaaaatggtacgcgattttgcc
gtgaaggaagtggcaccgacagcagcggaacgcgatgagaacgaacggtttgaccgtggc
atttttgaccagatggcggcgctcggcctgaccgggattccatggccggagcagtacggc
gggatcgggagcgattttctggcatactgcattgcggtggaagagctgtcgcgtgtgtgc
gcctcaaccggcgtgaccctttccgcacacacttcccttgccagctggccgctgtttaaa
ttcggcacagaagaacaaaaacagaaatacctcgttccgcttgcccgcggggaaaaaatc
ggtgcgtacggcttgacggagccggggtcgggttccgatgcaggcgcgatggtgacaacg
gccaggcgtgaaggcgaccactatgttttaaacggctccaaaattttcattacaaacggc
ggcgtggcggatatttacatcgtgtttgccctcaccgatccgaaaagcaaacaccatggc
acaagcgcgtttattattgaaaaagattttcccgggttttcaaccggcaaaaaagaaaag
aaaatgggcatccgggcttccaccacaacggaaatcatttttgacaatgtcatagtgccg
gcagaaaaccggctcggggaagaaggacagggctttaaaatcgcgatgatgacgctggac
ggcgggcgtaacggcattgcggcccaggcagtcggcattgcccagggcgcactggatgcg
gctacagcttatgcgaaagagcggaaacaattcggcaaaccgatcgcagcgaaccagggc
gtgtctttcaaacttgccgatatggccactgcagtcgaagcggcaaggctgttaacgtac
caggcggcctggcttgaatcaaacgggctgccgtacggaaaagaatccgccatgtccaaa
ctgtttgccggcgatacggcgatgaaagtcacaacggaagccgtgcagatttttggcggc
tacggctatacaaaagattatccggttgagcggttcatgcgcgatgctaaaattacgcaa
atttacgaagggacgcaggaaatccagcggcttgttatttcaagaatgctgacaagggac
tga

DBGET integrated database retrieval system