KEGG   Bacillus coagulans 36D1: Bcoa_1485Help
Entry
Bcoa_1485         CDS       T01628                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00473  D-Alanine metabolism
bag00550  Peptidoglycan biosynthesis
bag01100  Metabolic pathways
bag01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bcoa_1485
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bcoa_1485
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Bcoa_1485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bag01011]
    Bcoa_1485
Enzymes [BR:bag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Bcoa_1485
Peptidoglycan biosynthesis and degradation proteins [BR:bag01011]
 Precursor biosynthesis
  Amino acid ligase
   Bcoa_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEP00691
UniProt: G2THX3
LinkDB All DBs
Position
1604865..1605932
Genome map
AA seq 355 aa AA seqDB search
MKKKICLLYGGKSAEHEVSLQTAKAVIQALDHEKYDIYPIFITTEGDWIKGPLLTGPVET
VKQLEFRDGKKMAPNALSTTVSGEKGGYDVIFPLLHGPNGEDGTVQGMLELLNLPYVGNG
VLASSAGMDKVIMKNLFAQAGLDQVKYVSFIRSEWENALETCFQQVEEKTGYPCFVKPAN
LGSSVGISKCKNRTELEAAFKEAFQYDRKIIVEEGVTAREIELGVIGNDDPQCSVAGEIV
AKKDFYDYKAKYEDGETALIIPADIPEKVYKKCTEAAITAFKALDCSGLVRADFFVTEDE
RVIINEINTMPGFTPFSMFPLLWKEAGLDYPQLIEKLIELALERHAEKQRIKYTL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaatctgtttgctttacggcgggaaatccgctgaacacgaagtatccctg
caaaccgccaaagctgtaatacaggccttggatcacgaaaaatacgatatttaccccatc
ttcattacaacggaaggggactggataaaagggccgcttttaaccggacctgttgaaacc
gtgaaacaacttgagttccgtgacggaaagaaaatggcccccaatgcgctgtcaaccact
gtatcgggtgaaaaaggcggctatgacgtcatttttccgctgctgcacgggccaaacggg
gaagacggcaccgtacagggcatgcttgaactgttaaacctgccgtatgtcggaaacggc
gtgcttgcctcttcagccggaatggataaagtaattatgaaaaacctgtttgcacaagcc
gggctcgaccaagtgaaatatgtttcttttatccggagtgaatgggaaaatgcgctcgaa
acctgttttcaacaagtggaagaaaagaccggctacccttgtttcgtcaaaccggcgaat
ctcggttcaagcgtcgggatcagtaagtgtaaaaaccgcacggagttggaagcagcattt
aaggaagcctttcagtacgaccggaaaatcattgtcgaagaaggcgtcacggccagggaa
attgaacttggcgtgatcgggaatgacgatccgcaatgttccgttgccggcgaaattgtc
gcgaaaaaagatttttacgattataaagcgaaatacgaagacggggaaacggcgttaatc
attccggccgatattcccgaaaaagtgtataaaaaatgtaccgaagctgcgattacagca
tttaaagcactcgactgctcggggctggtgcgtgctgacttttttgtgacagaagacgaa
cgggtgatcatcaatgaaatcaatacgatgcccggatttacaccgttcagcatgtttccg
cttctgtggaaagaggcagggctggattacccgcagctgatcgaaaagctgattgaactt
gccctggagcgacatgcggaaaaacagcggattaaatatactttgtaa

DBGET integrated database retrieval system