KEGG   Bacillus coagulans 36D1: Bcoa_1503Help
Entry
Bcoa_1503         CDS       T01628                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00473  D-Alanine metabolism
bag01100  Metabolic pathways
bag01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bcoa_1503
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Bcoa_1503
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bag01011]
    Bcoa_1503
Enzymes [BR:bag01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Bcoa_1503
Peptidoglycan biosynthesis and degradation proteins [BR:bag01011]
 Precursor biosynthesis
  Racemase
   Bcoa_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEP00709
UniProt: G2TIL8
LinkDB All DBs
Position
1629129..1630280
Genome map
AA seq 383 aa AA seqDB search
MAFYRDTWVEVDLDAISENVGNMRQLLPEHTQIIAVVKANAYGHGAEYVAKTALASGASA
LAVAFLDEALALRKKGITAPILVLGAARPEDAGVAAEENISLTVFQKDWLEEAGRYLTGR
KLSVHLKCDTGMGRIGVRTLQELKEVEKIVNQQSCFYFEGIFTHFATADEIDTTLYEKQY
SQFQDMVLNLEHRPPYVHCANSAAALRFDQSPFNAVRFGIAMYGLSPSPAIKPVLPFPLK
EAFSLHTKVTHVKQIHAGDTVSYGATYQASGDEWIATLPIGYADGWIRRLSGQEVIIDGE
RAPIVGRICMDQCMVKLARPVAVGTKATLIGKQGDLSIPVDEIAEKLETINYEVTCSISS
RVPRIFLKNGNDVADVSNPVLEG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggctttttaccgggatacatgggtggaagtcgatttggatgccatttcggaaaatgtc
ggaaatatgcgccagcttttgcccgagcatacgcaaatcattgcggttgtaaaagcgaac
gcctacgggcacggcgcggaatatgtggcgaaaaccgcgcttgcatccggagcttcagcg
cttgcggttgcatttttggacgaggcgctcgcgttacgaaaaaaagggattaccgctccg
atacttgttttgggggcagcccgtccggaagatgccggagtcgcggctgaagaaaacatc
tccctgactgtttttcaaaaagactggcttgaggaagcaggccggtatttaaccgggcgg
aaactatccgtccatcttaaatgtgataccggaatgggccggattggcgtaagaacccta
caggaattaaaagaagtggaaaaaatcgtgaaccaacaatcctgtttctattttgaaggg
atctttacccactttgcgacagcggatgaaatcgatacgactttgtatgaaaagcaatat
agccagtttcaggatatggttttaaacctcgaacaccgcccgccgtatgtgcactgcgca
aacagcgccgccgctttgagatttgaccagtctccgtttaatgctgtccgtttcggcatt
gcaatgtacgggctctccccttcgcccgccatcaagccggttttgccgtttccgttaaaa
gaggcgttctcccttcatacgaaggtgacgcatgtgaaacaaatccatgccggggacacg
gtgagttatggtgccacttatcaggcttccggcgatgaatggatcgccacgctgccgatt
ggatatgcagatggctggatccgcaggctttcaggtcaggaagtgatcattgacggggaa
agagcgcctattgtcggcaggatttgcatggatcaatgcatggtcaagcttgcccgtccg
gttgctgtcgggacaaaagcaaccttgattggaaagcagggagatttgtccattcctgtt
gacgaaattgccgaaaagctcgaaaccatcaactacgaggttacctgttccatttcaagc
cgggtgccgcgcattttcctgaaaaacgggaacgatgtcgcggacgtgtcgaatccggtc
cttgaaggttga

DBGET integrated database retrieval system