KEGG   Bacillus coagulans 36D1: Bcoa_1579
Entry
Bcoa_1579         CDS       T01628                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01715  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00650  Butanoate metabolism
bag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcoa_1579
Enzymes [BR:bag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bcoa_1579
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AEP00780
UniProt: G2TJ17
LinkDB
Position
1703946..1704725
AA seq 259 aa
MSHQYLLCEKEESVAVVTINRPPVNPLSTQVFQELSHIFHELDADDEVRAIVLTGSGEKA
FVAGADINEMAGLDLVGVNKMNKMSRAVFTQIENTSKPVIAALNGLALGGGFELALVCDL
RISSEKAKFAFPEAGLGIIPGGGGTQRLQKIVGQGVAKELLYFGEMIDANRALALHIVNK
VVPPDEVLDTAKEWARKLAQKPPVAMQMLKTAVNAGSNTDIETGLTIEAACFGNAFSTED
RKEGLNAFVEKRKPAFSGR
NT seq 780 nt   +upstreamnt  +downstreamnt
gtgagtcatcaatatttgctatgcgaaaaagaagagtcggttgcagtcgtcacaatcaat
aggccgcctgtcaatccgctcagcacacaagtattccaggagttatcgcatatttttcat
gaactggatgcagacgatgaagtacgcgccattgtcctgaccggaagcggggaaaaagcg
tttgtggccggcgccgatattaatgaaatggccgggcttgaccttgtcggtgtgaacaaa
atgaataaaatgtcgcgggcggtttttacccaaatcgaaaatacatcgaaaccggtcatt
gccgcgttaaacggccttgcattgggcggcggttttgaacttgcacttgtctgtgatttg
cggatcagttccgaaaaagctaaatttgcttttccggaagccggcctcgggattattccg
ggcggcggcggtacccagcgcctgcaaaaaatcgtcgggcagggggtcgcaaaggagttg
ctctacttcggggagatgatagacgcaaaccgtgcgcttgcgctgcatattgtgaataaa
gttgtaccgccagatgaagtgctagatacagcgaaagagtgggcccggaaacttgcacag
aagccgccggtcgcaatgcaaatgctaaaaacagcagtcaatgccggctcgaataccgat
atagaaaccgggcttacgattgaagcggcctgctttggcaatgctttttccaccgaagac
cgaaaagaaggattaaacgcttttgttgaaaaaaggaaaccggctttttctggcagatag

DBGET integrated database retrieval system