KEGG   Bacillus coagulans 36D1: Bcoa_1632Help
Entry
Bcoa_1632         CDS       T01628                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00970  Aminoacyl-tRNA biosynthesis
bag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bag00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bcoa_1632
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bag03029]
    Bcoa_1632
Enzymes [BR:bag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Bcoa_1632
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Bcoa_1632
Mitochondrial biogenesis [BR:bag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Bcoa_1632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey MOZART1
Motif
Other DBs
NCBI-ProteinID: AEP00829
UniProt: G2TJ66
LinkDB All DBs
Position
1767021..1768454
Genome map
AA seq 477 aa AA seqDB search
MNFETVIGLEVHVELKTNTKIFSPAPAHFGAEPNTNTNVIDLGYPGVLPVLNKKVVDYAM
KAAMALNCEIATETKFDRKNYFYPDNPKAYQISQFDKPIGKNGWIEIEVDGIKKKIGITR
IHMEEDAGKLFHAANEGYSLVDLNRQGTPLIEIVSEPDIRTPEEAYAYLEKLKSIIQYTG
VSDCKMEEGSLRCDANISIRPIGQETFGTKTELKNLNSFNYVRKGLQYEQERQKQVLLAG
GVIQQETRRFDEATGKTILMRVKEGSDDYRYFPEPDLVDLYIDDAWKERVRAEIPELPDE
RKKRYTEELGLPAYDAMVLTLTKEMSDFFEATIAAGADAKQASNWLMGEVSAYLNSAQKE
LHDIALTPESLAGMIKLIENGTLSSKLAKKVFRELVEKGGDPEKIVKEKGLVQISDEGEL
LKIVTEVLDKNEQSIIDYKNGKDRALGFLVGQVMKATKGQANPPIVNKLLIQEMNKR
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacagtgatcggacttgaagtgcacgttgaactcaaaaccaatacgaaa
attttctcgccggcgcctgcgcatttcggggcagaaccgaatacgaacacaaatgttatt
gatctcggctatccgggggtgcttccggtactgaataaaaaagtggttgactacgcaatg
aaggcggccatggcgctgaactgcgaaattgcaaccgaaacgaaattcgaccggaaaaac
tatttttacccggacaacccgaaagcctatcagatttcccaatttgataaaccgatcggg
aaaaacggctggattgaaatcgaagtggacggcataaagaaaaagatcggtattacccgt
attcacatggaagaagacgccgggaaactgttccacgcggcaaatgaagggtattctctc
gtcgatttgaaccgccaaggcacgccactaattgaaattgtttcggaaccggatattcgt
acgccggaagaagcgtatgcgtatcttgaaaaattaaaatccatcattcaatataccggc
gtttccgactgcaaaatggaagaagggtcactccgctgcgatgccaatatttccatccgt
ccaatcgggcaggaaacattcggcacgaaaaccgaactgaaaaacttgaactcgttcaac
tatgtgcgcaaaggcctgcagtatgagcaggaacgccagaaacaagtgctgcttgcaggc
ggtgtgatccaacaggaaacacgccgttttgacgaagcaaccggcaaaacgattttgatg
cgggtgaaagaaggctcggacgattaccgctatttcccggaaccggatcttgtggatctg
tatattgatgacgcctggaaagaacgggtgcgcgccgaaatcccggaacttccggatgaa
cggaaaaagcgttacacggaagaactcgggctcccggcttatgatgccatggtgctcaca
ctcacgaaagaaatgtccgatttctttgaagcgacgatcgcagccggcgccgatgcaaaa
caggcatcgaactggctgatgggcgaagtgtccgcgtacttgaattcagcccagaaagaa
ctgcatgatattgctctgacaccagaaagccttgccggcatgatcaaattgatcgaaaac
ggcacgctctcttcaaaattggcgaagaaagtgttccgcgaactggtcgaaaaaggcggc
gacccggaaaaaatcgtcaaggaaaaaggacttgtgcaaatttctgatgaaggcgagctt
ttaaaaattgtaacagaagtgctggataaaaacgaacaatccattattgactataaaaac
ggaaaagaccgggcgctcggctttttggtcggacaggtcatgaaagcaacaaaagggcag
gccaacccaccgattgtcaataaactgctgattcaggaaatgaataaacgttaa

DBGET integrated database retrieval system