KEGG   Bacillus coagulans 36D1: Bcoa_1663
Entry
Bcoa_1663         CDS       T01628                                 

Definition
(GenBank) acetoin reductase
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcoa_1663
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     Bcoa_1663
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     Bcoa_1663
    1.1.1.-  
     Bcoa_1663
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N TrkA_N NmrA Epimerase
Other DBs
NCBI-ProteinID: AEP00858
UniProt: G2TJ95
LinkDB
Position
complement(1797666..1798439)
AA seq 257 aa
MSKVAIVTGSAGGLGKGIAERLCSDGFSVVVHDINEQLLNETVNEFKNKGYDVIGVKGDV
SKRNDQFNLVKKGVEKFGHLDVFVNNAGIDAVSPFLEITEEQLNKLFSINVNGVVFGTQA
AAEQFISQKSKGKIINACSIAGHESYEMLGTYSATKHAVKSFTHSAAKELAKYQITVNAY
CPGVAKTKMWDRIDEEMVKYSDDLKPGEAFEKFSSEIALGRYQTPEDVANLVSFLASDDA
DYITGQAILTDGGLVYR
NT seq 774 nt   +upstreamnt  +downstreamnt
atgtctaaagttgcaattgtaacaggatcagctggtgggttaggaaaaggcattgcagaa
agattatgctcagatggttttagtgttgttgttcatgatattaacgaacaactattaaat
gaaaccgtcaacgaatttaaaaataaaggttatgatgttattggcgtcaaaggtgacgtg
tctaaacgaaatgaccaatttaatcttgttaaaaaaggtgttgagaagtttggccattta
gatgtatttgtaaataatgctggaattgatgcagtatccccattcttagaaattacagag
gaacagctgaataagctctttagtattaatgtaaatggcgttgtttttggaacacaagca
gcagccgaacaatttataagccagaaatcaaaagggaaaattatcaacgcatgcagtata
gctggacatgaatcctacgaaatgttgggtacatactcagctacgaaacacgcagttaaa
tcctttactcattccgctgccaaagaattagccaaatatcaaattacagtgaatgcatac
tgccctggtgtcgctaagacgaaaatgtgggatcgaattgatgaagaaatggtcaaatat
agtgatgatttaaaacctggtgaagcatttgaaaagttttcttctgaaatagcattagga
agatatcaaaccccggaagatgtagcaaacttagtttcattcttagcatcagatgacgct
gattatataacaggacaagcaattttaacagatggtggacttgtatatagataa

DBGET integrated database retrieval system