KEGG   Bacillus coagulans 36D1: Bcoa_1873
Entry
Bcoa_1873         CDS       T01628                                 

Definition
(GenBank) pyruvate carboxyltransferase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00072  Synthesis and degradation of ketone bodies
bag00280  Valine, leucine and isoleucine degradation
bag00281  Geraniol degradation
bag00650  Butanoate metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcoa_1873
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bcoa_1873
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcoa_1873
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Bcoa_1873
Enzymes [BR:bag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     Bcoa_1873
SSDB
Motif
Pfam: HMGL-like Peptidase_M57
Other DBs
NCBI-ProteinID: AEP01060
UniProt: G2TK59
LinkDB
Position
2041693..2042601
AA seq 302 aa
MKLPEKVTVKEVGPRDGLQNEKAVVATEEKIAWINALSDTGLTYIEAGSFVRPEWIPQLA
DTGAVLEKIRRKPGVTYAALVPNVRGLERALNAGVDEVSVFMSASEGHNLRNINKTIAET
YPVLEKVVKEAKSAGKSVRGYISTVIACPYDGPVSPKQVKDVAGRLFAMGVDEISLGDTI
GAGVPTDVERLLDELLHDFNARQLAMHFHDTRGTALANVVKSLEMGITVFDSAAGGLGGC
PYAKGASGNVATEDLLYLFAQMGIETGIDFDRIIQAAKQIEKTIGRPLASHQMEIYRMAG
GA
NT seq 909 nt   +upstreamnt  +downstreamnt
gtgaagctgcctgaaaaagtgaccgtgaaagaagtcggaccgcgcgacgggctgcaaaat
gaaaaggcggtcgtggcgacagaagaaaaaattgcatggatcaacgcattgtcagatacg
ggtctgacgtacatcgaagcaggatcattcgtccggccggaatggataccgcagcttgcc
gataccggagcggtgctggaaaaaatcagacggaagccgggcgtgacctatgccgcgctt
gtcccgaacgtgagggggcttgagcgggccttaaatgcaggtgtggatgaagtaagcgtc
tttatgtcggcaagcgaaggccataacctccgcaacattaataaaacgatcgctgaaacc
tatccggtcttggaaaaagtggtgaaggaagcgaaaagcgccgggaaatcggtaagggga
tatatttcgacggtgattgcctgcccgtatgatggaccggtttccccaaagcaagtaaaa
gatgtggccggccgcttgtttgcgatgggcgtggatgaaatttccctcggggatacgatc
ggtgccggcgtgccgactgatgttgagcggttgctcgacgaactgcttcatgattttaat
gcaaggcagctggcgatgcatttccacgatacaagagggacggcacttgcgaatgttgtt
aagtcgctcgaaatggggatcactgtttttgacagcgcagcaggtggcctgggcggctgt
ccgtatgcgaaaggggcatccggcaatgttgccacggaagatttgctgtacctgttcgcg
caaatgggcattgagaccggcattgattttgaccgcatcatccaggccgcaaagcagata
gaaaaaacaatcggaaggccacttgcaagccatcagatggaaatttacaggatggcggga
ggggcgtaa

DBGET integrated database retrieval system