KEGG   Bacillus coagulans 36D1: Bcoa_1907
Entry
Bcoa_1907         CDS       T01628                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00250  Alanine, aspartate and glutamate metabolism
bag00280  Valine, leucine and isoleucine degradation
bag00310  Lysine degradation
bag00410  beta-Alanine metabolism
bag00640  Propanoate metabolism
bag00650  Butanoate metabolism
bag01100  Metabolic pathways
bag01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcoa_1907
   00650 Butanoate metabolism
    Bcoa_1907
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcoa_1907
   00280 Valine, leucine and isoleucine degradation
    Bcoa_1907
   00310 Lysine degradation
    Bcoa_1907
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcoa_1907
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bag01007]
    Bcoa_1907
Enzymes [BR:bag01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Bcoa_1907
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Bcoa_1907
    2.6.1.48  5-aminovalerate transaminase
     Bcoa_1907
Amino acid related enzymes [BR:bag01007]
 Aminotransferase (transaminase)
  Class III
   Bcoa_1907
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: AEP01094
UniProt: G2TLL0
LinkDB
Position
complement(2079879..2081237)
AA seq 452 aa
MTNANVYSSLPGPLSKELLERREKAVPRGVSNGIPVFAKEAKGALVTDVDGNTYIDFAGA
IGTLNVGHNHPKVVAAVKEQLERFIHTGFNVMMYEPYIELAEKLAALAPGNAEKKVILLN
SGAEAVENAVKIARKYTKRPAIISFTRGFHGRTLMTMSMTSKVKPYKYEFGPFASEVYKA
PYPYAYRKPGNLTDEEYEDYMIQEFRNFFQNDVAAETVAAVVMEPVQGEGGFIVPGKKFV
KAVYDFCQENGILFVSDEIQAGFSRTGRYFAIEHFDVVPDLMTISKSLAAGVPLSGVIGR
SDIMDAANPGELGGTYAGSPLGCAAALAVLDIIESEKLNERAEKIGRHVLDTFRSWQKEF
TFIGDVRGLGAMCAFEVVKDKTTKEPDKALTKRIVKEANKRGLLLLDAGIFGNVIRILMP
IVITDDQLQEGLDILKQSIAAAANVKEEISLL
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgacaaatgcaaatgtatactcttctctgccgggaccgctttcgaaagaactgctggaa
agaagggaaaaagccgttccccgcggtgtcagcaacggcattccggtttttgcaaaagaa
gcaaaaggcgcgcttgttacagatgtggacggcaatacgtatattgattttgccggcgca
atcggcacgctgaatgtcgggcataaccacccgaaagttgtcgcagctgtcaaagaacag
cttgaacgttttatccataccggctttaacgtcatgatgtatgaaccttatattgaactg
gctgaaaaattggcagcgctcgctccggggaatgcggagaaaaaggtcatccttttaaac
agcggggcagaagccgtcgaaaatgccgttaaaattgcccgcaaatatacgaagcggccg
gccattatcagctttacccgcggctttcacggcagaacgttaatgacgatgtcgatgaca
agcaaagtgaagccgtataaatacgaattcggcccgttcgcttctgaagtttataaggcg
ccttacccttatgcttaccggaaacccggcaatttgaccgatgaagaatatgaagactat
atgatccaagagttccggaatttctttcaaaacgatgttgccgctgaaacggttgcggct
gtggtcatggaaccagtacagggagaaggcggattcattgtgccaggcaaaaaatttgta
aaagcggtttatgacttctgccaggaaaacggcattttgttcgtatcggacgaaatacag
gcaggattcagtcggaccgggcgctattttgccattgagcattttgatgttgtgccggat
ttgatgaccatttcgaaatctcttgcagcaggcgtcccgttaagcggggtaatcggacgg
agcgacataatggatgcggcaaatccgggtgaacttggcgggacttatgccggaagcccg
cttggatgcgcagccgcccttgccgtactggacatcattgaatctgaaaaattaaacgaa
cgggcggaaaaaatcgggagacatgtgcttgatacgttccgcagctggcagaaggagttt
acctttatcggggatgtgcgcggacttggcgccatgtgtgcatttgaagtcgtaaaagac
aaaacgacaaaagaaccggataaagcattgacaaagcggattgtgaaagaagccaacaag
cgggggctgcttcttttggatgccgggattttcggcaatgtcatccgcattctgatgccc
attgtcattacagacgaccagctgcaggaaggcctggatattttaaaacagtccattgcc
gctgccgcaaacgtaaaggaagaaatatctttattatga

DBGET integrated database retrieval system