KEGG   Bacillus coagulans 36D1: Bcoa_2135
Entry
Bcoa_2135         CDS       T01628                                 

Definition
(GenBank) alpha-acetolactate decarboxylase
  KO
K01575  acetolactate decarboxylase [EC:4.1.1.5]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00650  Butanoate metabolism
bag00660  C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcoa_2135
   00660 C5-Branched dibasic acid metabolism
    Bcoa_2135
Enzymes [BR:bag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.5  acetolactate decarboxylase
     Bcoa_2135
SSDB
Motif
Pfam: AAL_decarboxy
Other DBs
NCBI-ProteinID: AEP01319
UniProt: G2TN17
LinkDB
Position
2329877..2330626
AA seq 249 aa
MRTAAENQNTEQILTSRTDEVYQLSTMTSLLDGVYESDKTFAELKKFGDFGIGTFNHLDG
ELIAFDNAFYQLKDGTAKRVQPEDKSPFCSLAHFSEDITYTAEGPLAKPELEDLIKDLVR
SENLFYAIRVDGVFKKMNTRTVSYQEKPVPMTEAVKSQPVYSFENTKGTLSGFWTPMFAQ
GIAVAGFHLHFIDDKRTGGGHVFDYVLDYGTIRISKKTHMHLELPETDAFLNANLSRANL
AEELEKTEG
NT seq 750 nt   +upstreamnt  +downstreamnt
atgcgtactgctgcagaaaatcaaaatacagagcaaattttaacaagccggaccgatgaa
gtataccaattgtccacgatgacatcgcttcttgacggcgtatacgaaagcgacaagacg
tttgctgaattaaaaaagttcggcgatttcggcatcggcactttcaaccatttggacggg
gaattgattgcctttgacaatgcgttctatcagctgaaggacgggacggcaaaacgtgta
cagcctgaagacaagtcaccgttttgctcgcttgcacatttttcggaggatatcacctat
acagctgaaggtcctctagcaaaacccgaactggaagacttgatcaaagatctcgtccgc
agcgaaaatttattttatgccattcgtgtggacggtgtttttaaaaaaatgaacacaaga
accgtctcctaccaggaaaaaccggttcccatgacggaagcggtgaaatcccagccggtt
tactcgtttgaaaatacaaaaggaacgctttctggtttttggacgccgatgtttgcacaa
ggaatcgcggtcgccggcttccacctccattttattgacgacaaacgcaccggcggcggc
catgtctttgactatgtgcttgactacgggacgatccggatcagcaaaaaaacgcatatg
catctggaacttccggaaacagacgcttttttaaatgcgaacctttcccgcgccaatttg
gcagaggaactggaaaagacagaaggctga

DBGET integrated database retrieval system