KEGG   Bacillus coagulans 36D1: Bcoa_2164
Entry
Bcoa_2164         CDS       T01628                                 

Definition
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00620  Pyruvate metabolism
bag00640  Propanoate metabolism
bag00650  Butanoate metabolism
bag01100  Metabolic pathways
bag01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcoa_2164
   00640 Propanoate metabolism
    Bcoa_2164
   00650 Butanoate metabolism
    Bcoa_2164
Enzymes [BR:bag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Bcoa_2164
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: AEP01346
UniProt: G2TN44
LinkDB
Position
complement(2367397..2369661)
AA seq 754 aa
MTEQLLTKATLSKKQWEGFKGGNWQKEIDVRDFILKNVTPYEGDESFLAGPTEATLKLWD
QVMELSKQEREKGGVLDMDTKIVSTITSHGPGYLNKELEKIVGFQTDKPFKRSMMPFGGI
RMAESALKSYGYEIDPEIKHIFTEWRKTHNQGVFDAYTPEIKAARHAGIVTGLPDAYGRG
RIIGDYRRVALYGVDYLIEQKKKDLDLIGCGLMTEEVIREREEHSEQIRALQELKQMAQS
YGFDISEPASNAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDIYIERDLKNGVLTER
EAQELVDHFVMKLRLVKFARTEDYNELFSGDPTWVTESIGGMALDGRTLVTKNSFRFLNT
LDNLGPAPEPNLTVLWSTKLPDKWKQYCAKMSIKTSAIQYENDDLMREEYGDDYGIACCV
SAMRIGKQMQFFGARANLAKALLYAINGGVDERYKMQVAPPFQPITSEYLDYDEVMEKYD
RMLDWLAGVYINALNIIHYMHDKYSYERLEMALHDRNVLRTMACGVAGLSVAADSLSAIK
YAKVKVIRDEDGLAVDYEVEGDYPKYGNNDDRVDQIAVNLVKSFMQKLQKYPTYRNAVHT
SSILTITSNVVYGKKTGSTPDGRKAGEPFAPGANPMHGRDSHGAVASLTSVAKLPYKYSL
DGISNTFSIVPEALGHEEETQVSNLDGMLDGYMAKKAHHLNVNVLHRETLLDAMDHPEKY
PQLTIRVSGYAVNFIKLTREQQLEVINRTFHEMM
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgactgaacaattactgacaaaagcaacgctctccaaaaaacaatgggaaggcttcaaa
ggaggaaactggcaaaaagaaatcgatgtaagggacttcattttgaaaaatgtaacccct
tacgaaggcgatgaaagctttcttgccggcccgactgaagccactttaaaattatgggat
caggtcatggaactgtcgaaacaggaacgcgaaaaaggcggcgtcctggatatggatacg
aaaattgtatccaccattacctcgcatggcccaggctatttaaacaaagaacttgaaaaa
attgtcggtttccaaaccgataaaccgttcaaacgttcgatgatgccgtttggcggaatc
cggatggcagaaagtgccttaaaatcttacggctatgaaattgatccggaaatcaaacat
atttttacagaatggcggaaaacccataaccagggtgtattcgatgcctacacaccggaa
atcaaagctgcacggcatgccggcattgtaacaggccttccggatgcttacggccgcggc
cgcattatcggcgactaccggcgcgttgccctttacggtgtagattatttaattgagcaa
aagaaaaaagatctcgatttaatcggctgcggcttgatgacagaagaagtcatccgtgaa
cgtgaagaacattcggaacaaattcgtgcattgcaagaattgaaacaaatggcacaaagc
tacggattcgatatttccgaaccggcttcaaacgcacaagaagctttccaatggctgtat
ttcgcgtatctggctgccattaaggaacaaaatggtgcggccatgagtcttgggcgcaca
tccactttccttgacatttatattgaaagagatttgaaaaacggtgtcctgactgaacgg
gaagcacaagaactcgtcgaccactttgtcatgaaactccgcctcgtcaaatttgcaagg
acggaagattacaatgaactgttcagcggcgacccgacatgggtaacagaatcgatcggc
ggcatggctttggacggccgtacactcgttacgaaaaactcgttccgcttcctgaacacg
ctcgataatctcggccctgcgccggaaccgaacctgaccgtgctctggtcgacgaaactg
ccggataaatggaaacaatattgcgcgaaaatgtcgatcaagacaagcgccatccaatat
gaaaacgacgacttaatgcgtgaagaatacggagacgattatggcattgcctgctgtgta
tcggcgatgcggatcggcaaacaaatgcaattcttcggcgcccgtgccaacctggcaaaa
gctttgctgtatgcgattaacggcggcgttgatgaacggtataaaatgcaagtcgcacct
ccgttccagccgatcacatcggaatatctcgattacgatgaagtcatggaaaaatacgat
cggatgctagactggcttgcaggcgtttatatcaatgctttgaacatcattcattatatg
catgacaaatacagctatgaacggcttgaaatggcattgcatgatcgcaatgtactgcgc
acgatggcttgcggcgttgccggcctgtctgttgcagccgactctctaagcgccatcaaa
tacgcgaaagtaaaagtcatccgtgacgaagacggccttgctgttgactatgaagtcgaa
ggcgattacccgaaatacggcaacaacgatgaccgcgtcgaccaaattgccgtcaatctc
gtcaaatcgtttatgcaaaaactgcaaaaatatccgacttaccggaacgctgtccatact
tcttcgatcttgacgattacatcgaacgttgtatacggcaagaaaacaggaagcactccg
gacggccggaaagcaggcgaaccgttcgcacctggtgcaaacccgatgcacggccgcgat
tcccacggcgcagtcgcatcgttgacatctgttgcgaaactgccttataaatattcgctt
gacggcatttccaacactttctcgattgtcccggaagcgctcggacacgaagaagaaaca
caggtctccaacctggacggcatgctggacggctatatggcgaaaaaagcgcaccactta
aacgtcaacgtcctgcatcgcgaaacattgctggatgcgatggatcatccggaaaaatat
ccgcaattgacgatccgtgtatcgggatatgcggtaaacttcatcaaattgacaagggaa
caacaacttgaagtcattaaccgcacgttccatgaaatgatgtaa

DBGET integrated database retrieval system