KEGG   Bacillus coagulans 36D1: Bcoa_2237Help
Entry
Bcoa_2237         CDS       T01628                                 

Definition
(GenBank) 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00030  Pentose phosphate pathway
bag00630  Glyoxylate and dicarboxylate metabolism
bag01100  Metabolic pathways
bag01120  Microbial metabolism in diverse environments
bag01200  Carbon metabolism
Module
bag_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcoa_2237
   00630 Glyoxylate and dicarboxylate metabolism
    Bcoa_2237
Enzymes [BR:bag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     Bcoa_2237
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     Bcoa_2237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase QRPTase_C Flavi_NS2B
Motif
Other DBs
NCBI-ProteinID: AEP01419
UniProt: G2TP95
LinkDB All DBs
Position
2439300..2439977
Genome map
AA seq 225 aa AA seqDB search
MKKMQTLQALEKNGIVAVLRADSVEKALRITDALIAGGIKSIELTFTVPNADVAIKKLTE
LYQDRDDVLVGAGTVLDAQTAQTAQMAGAKFIVAPTFDPETAAFCNLYQIPYIPGCMTVN
EMKAAMQAGAEVIKLFPSNIVGPAFVKDVKAPLPQLEIMPSGGISLDNMGNWIKAGCKIL
GVGGSLLKPAETNDFAKVTETARAFVDKYQQLTEAVHQQSRGQYA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgcagactttgcaggcgttagaaaaaaatggaattgtggccgtgctgcgt
gcagactccgttgaaaaagctttgcgtattacggatgcactgattgccggcgggatcaaa
agcatcgaactaacttttaccgttccgaatgcggatgttgccatcaaaaaattgacggaa
ctgtaccaagaccgtgatgatgtcctcgttggagctggcactgtcctggatgcccagacc
gcccagaccgcgcaaatggccggggcaaaattcatcgtcgcgccgacatttgatccggaa
acggctgctttttgtaacctttatcaaatcccttatatcccgggctgtatgacggtaaat
gaaatgaaagcggccatgcaggcaggggcagaagtgattaaactgttcccgagcaatatt
gtcgggccggcatttgtaaaagacgtaaaagctccgctgccgcaacttgaaatcatgcct
tcaggcggaatcagtctggacaatatgggaaattggatcaaagcaggctgtaaaatcctt
ggcgtaggcggaagcttattgaaacctgccgaaaccaatgattttgcgaaagtgaccgag
acagcaagagcgtttgtggacaaatatcagcaactaacagaagccgtgcatcagcaatcg
aggggtcaatatgcctaa

DBGET integrated database retrieval system