KEGG   Bacillus coagulans 36D1: Bcoa_2334Help
Entry
Bcoa_2334         CDS       T01628                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcoa_2334
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Bcoa_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Bclx_interact
Motif
Other DBs
NCBI-ProteinID: AEP01514
UniProt: G2TKM2
LinkDB All DBs
Position
2539171..2540640
Genome map
AA seq 489 aa AA seqDB search
MEKYLNYIDGEWCEPSTGKFAPVVNPANGKTLGEVAQSAEPDLDRAVQAAKSAQSVWRLV
PAPERANYLYKVGELLKQRKEQIARTLTSEMGKVIDEARGEVQEAIDMAFYMAGEGRRQF
GDTVPSELQNKFAMSIRVPVGIAGLITPWNFPIAIASWKSLPALVTGNAVIWKPATETPA
TACAFVKIYEEAGLPKGLVNLVHGSGSVIGEAMVEHPGIGLISFTGSNEVGRKINERAGG
LLKRTSLEMGGKNAVIVMDDADLDLAVDGILWGAFGTSGQRCTATSRVIVHKKIKDALEE
KLIRRTAELKIGDGLDETVAVGPVINTEALNRIHQYVETGKKEGARLLTGGRILPGKGYY
YAPTVFTDVSPEMVIAQEEIFGPVVSIIPVASLEEAIVVNNSVTFGLSSGIFTKDVNKAF
QAMRDLDTGIVYINAGTTGAEIHLPFGGTKGTGNGHRDSGPAALDVYTEWKAVYVDFSGK
LQRAQIDNN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatttgaattacattgatggcgagtggtgcgaaccgtcaacgggaaaattt
gccccggttgtaaatcctgcaaacgggaaaacattgggcgaagtggcgcaatccgccgaa
ccggaccttgaccgtgccgtccaggctgccaaaagcgcgcaaagcgtgtggcggctcgtc
ccggcacctgagcgcgcaaactatttatacaaagtcggggaactgttaaaacaaagaaaa
gaacagatcgcgcgcacgcttacaagcgaaatgggcaaggtgatcgatgaagcgcgcggg
gaagtacaggaagcgattgacatggccttttatatggcaggggaagggagacgccaattt
ggtgataccgtaccctctgagctgcaaaataaatttgcgatgagcatccgtgtgccggtc
ggcattgccgggctgatcacgccgtggaattttccgatcgccattgcttcctggaagtca
ctgccggcgcttgtaaccgggaatgcggtgatttggaagccagccacggaaacgccggca
acagcgtgcgcatttgtgaaaatttatgaagaagcggggctcccaaaagggcttgtcaat
cttgtccatggctccggttccgtgattggtgaagcgatggtggaacatccgggcatcggt
ctcatctcttttaccggatcaaatgaagtcgggcgtaaaattaacgaacgggcgggcggc
cttctgaaacggacttcgcttgaaatgggcgggaagaacgccgtgattgtcatggatgat
gcggatctcgatcttgcagtggacggcattctttggggcgcattcggcacgagcgggcaa
agatgcacggccacaagccgggtcatcgtccataaaaagatcaaagatgcactggaggaa
aaactgattcggcgaacggcggaattgaaaattggcgacggccttgatgaaacggtggca
gtcggcccggttatcaatacagaagcgctcaaccgcatccaccagtatgtcgaaacaggt
aaaaaagagggggcaaggctgcttacgggcgggcgcattttgccgggaaaaggatactac
tatgcgccgactgtttttacggatgtcagcccagaaatggtcattgcgcaggaagaaatt
ttcggcccggttgtttcgatcattccagtggcaagccttgaagaagcgattgtcgttaac
aacagcgtcacttttgggctgtcgagcggtatttttacaaaagatgtgaataaagctttt
caggcgatgcgtgatctggataccgggattgtctacatcaatgccgggacgacaggggct
gaaatccatctgccgttcggcgggacaaaaggaacgggcaacgggcaccgtgactcaggg
ccggcagcacttgatgtatacacggaatggaaggccgtgtatgtcgatttcagcgggaaa
ctgcagcgcgcccagatcgacaacaattag

DBGET integrated database retrieval system