KEGG   Bacillus coagulans 36D1: Bcoa_2521Help
Entry
Bcoa_2521         CDS       T01628                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00020  Citrate cycle (TCA cycle)
bag00480  Glutathione metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01130  Biosynthesis of antibiotics
bag01200  Carbon metabolism
bag01210  2-Oxocarboxylic acid metabolism
bag01230  Biosynthesis of amino acids
Module
bag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bag_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcoa_2521
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcoa_2521
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Bcoa_2521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEP01699
UniProt: G2TPH0
LinkDB All DBs
Position
2752294..2753568
Genome map
AA seq 424 aa AA seqDB search
MAQGEKITVENGVLNTPNHPIIPFIEGDGTGPDIWAAAQRVLDAAVEKAYKGEKKIVWKE
VYAGEKAFNKTGEWLPQETLDTIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFDGVPSPVKRPQDTDMVIFRENTEDIYAGIEYQEGSPEVKKVISFLQDEMGVKKIR
FPETSGIGIKPVSKEGTERLVRAAINYAIKEGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREFGDKVFTWSEYDRIKEEKGADAANQAQKEAEANGKIIIKDAIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLMLEHLGWNEAAKLIIGSMEKTIASKVVTYDFARLMDGAREVKCSEFGDELIK
NMGK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaggagaaaagatcaccgtagaaaacggcgtattaaacacaccgaatcacccg
attattccatttatcgaaggggacggcaccggccctgatatttgggcggctgcacagcgc
gtattggatgcggctgttgagaaggcctataaaggcgaaaagaaaattgtctggaaagag
gtctatgcaggggaaaaagcgttcaataaaacaggggaatggctgccgcaggaaacgctt
gacacgatccgcgaatatttcattgccattaaagggccattaaccactccggtcggcggc
gggatccgttcgctgaatgttgcgctgcgccaggaactcgacttattcgtctgcctgcgc
cctgtccgttattttgatggcgtcccttccccggttaaacgcccgcaggataccgatatg
gtcattttccgcgaaaacacggaagacatttatgccggcattgaatatcaagaaggttca
ccggaagtgaaaaaagtcatttcgtttttgcaagatgaaatgggcgtgaaaaaaatccgc
ttcccggaaacttccggcatcggcatcaaaccggtatcgaaagaaggaacggaacggctg
gtgcgcgctgcgattaactatgcgatcaaagaagggcgcaaatccgttacgctggtacat
aaaggcaatatcatgaaatttacggaaggcgcgtttaaaaactggggttacgaactggcg
gaaagggaattcggcgataaagtcttcacctggtccgaatacgaccgcattaaagaagaa
aaaggcgcggatgctgccaaccaggcgcagaaagaagcagaagcaaacggcaagatcatt
atcaaagatgcgattgccgatatcttcctgcaacaaattttgacccgtccgcgcgaattt
gacgtcgtcgcaacgatgaacttaaacggcgactacatttcggatgcgctcgctgcacaa
gtcggcggcatcgggattgcccctggcgcgaacatcaactacgaaaccggccatgccatt
ttcgaagcgacgcacggaacggcaccgaaatatgccggcttggataaagtgaacccttca
tccgttattttgtcgggtgttttgatgcttgaacatttgggctggaatgaagcggcaaaa
ttgattatcggttcgatggaaaaaacgatcgcatccaaagtggtcacatacgactttgcc
cgcctgatggatggcgcaagagaagtcaaatgctctgaatttggcgatgaactgattaaa
aacatggggaaataa

DBGET integrated database retrieval system