KEGG   Bacillus coagulans 36D1: Bcoa_2717Help
Entry
Bcoa_2717         CDS       T01628                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bag  Bacillus coagulans 36D1
Brite
KEGG Orthology (KO) [BR:bag00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcoa_2717
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bcoa_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO K_oxygenase Thi4 NAD_binding_8 NAD_binding_7 AlaDh_PNT_C FAD_binding_3 Glutaredoxin Thioredoxin_4 FMO-like DUF2190 Nitrate_red_del
Motif
Other DBs
NCBI-ProteinID: AEP01893
UniProt: G2TNF2
LinkDB All DBs
Position
2951312..2952868
Genome map
AA seq 518 aa AA seqDB search
MILDEEIKAQLAQYLQMMEGDVLLKVSAGSDETSRNMLELVDQLAAMSPRIKVENTKLDR
TPSFSVNRPGEDTGIVFAGVPLGHEFTSLVLALLQVSGRPPKVDQKVIDQIQSIKGEYHF
ETYVSLTCQNCPVAVQALNIMSVLNPNITHTMIDGAAFREEAEGKGIMAVPSIYLNGEFF
ESGRMEVEEILAKLGSTADPSEFEKKDPFDVLVIGGGPSGASAAIYAARKGIRTGIVAER
FGGQVLDTVGIENLIGTKYTEGPQLAANLEEHVKQYNVDIMNLQRAKRVEKKDLVEVELE
NGAVLKSKTVIISTGARWRNINVPGEAEFKNKGVAYCPHCDGPLFAGKHVAVIGGGNSGI
EAAIDLAGVVKHVTVIEFMPELKADRVLLERVYSLPNVTVVKNAQTKEITGTDKVNGITY
IDRATGEEHHIELEGVFVQIGLVPNTEWLGDTVERTPRGEIVVDKRGATSVPGVFAAGDC
TDSAYKQIIISMGAGATAALGAFDYIIRETKTDEAVHN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgatactggatgaagagattaaagcgcaactggcccagtatctgcaaatgatggagggc
gacgttctgctgaaagtgagcgcgggatccgatgaaacatcacggaacatgctcgaactg
gttgaccaattggctgccatgtcgccccggataaaagtggaaaacacaaaactcgacaga
accccgagtttcagtgtaaaccgaccgggagaagataccgggattgtattcgcaggcgta
ccgctcgggcatgagtttacatcgctcgttttggccctgttgcaggtcagcggccgccct
cctaaagtggatcagaaggttattgaccagattcaaagcataaaaggcgaataccatttc
gaaacctatgtcagcctgacttgccagaactgtcctgttgcggtacaagctttaaacatc
atgagtgtgctcaatccgaatattacgcacacgatgattgacggggctgcatttagagag
gaagcggaaggaaaaggcattatggccgtcccttccatttacctgaacggcgaattcttt
gaaagcggacggatggaagtggaagaaattcttgccaaactcggcagcacagcggatccg
tccgagtttgaaaagaaagacccgtttgatgtgctcgttatcggcgggggcccgtccggc
gcaagtgcagccatttatgcggcgcgcaaaggcatccggacagggattgtcgctgaacgt
tttggcgggcaggttctcgatacagtcggcattgaaaacttaatcggcacgaagtatacg
gaaggcccgcaacttgctgcaaaccttgaagaacatgtcaaacagtataatgttgatatt
atgaatctgcaacgtgcaaaacgggtcgaaaagaaagatctcgttgaggtggaattggaa
aacggggctgtattaaagagcaaaaccgtgatcatttccaccggtgcacgctggcgcaac
atcaacgtgccgggcgaagcagaattcaaaaacaaaggtgtggcctattgcccgcactgt
gacgggccgttgtttgccggtaaacatgtcgccgtaatcggcgggggcaattccggcatt
gaagcggccattgaccttgccggtgtagtcaaacatgtaaccgtcattgaatttatgcct
gaattaaaggcggaccgtgtgctgcttgagcgcgtttacagccttccaaatgtgacggtt
gtaaaaaatgcgcaaacaaaagagattaccggcacggataaagtgaacggcatcacatat
attgaccgtgcaaccggggaagaacaccatattgaactcgagggtgtgtttgtccaaatc
ggccttgtcccgaataccgaatggcttggtgatacagtggaacgcacaccgcggggtgaa
attgtggtggataagcgcggcgcgaccagtgttccgggcgtgtttgccgcaggagactgc
accgatagcgcttataagcaaatcattatttcgatgggggccggcgcgacagctgcgctc
ggtgcttttgattacatcatccgggaaacaaaaacggatgaagctgtacacaattaa

DBGET integrated database retrieval system