KEGG   Bacillus coagulans 36D1: Bcoa_2801Help
Entry
Bcoa_2801         CDS       T01628                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bag  Bacillus coagulans 36D1
Brite
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Bcoa_2801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEP01977
UniProt: G2TPL5
LinkDB All DBs
Position
3029528..3030136
Genome map
AA seq 202 aa AA seqDB search
MTYTLPQLPYAYDALEPYIDKETMNIHHTKHHNTYVTNLNKALEGHDDLASKSVEDLISD
LNAVPEEIRTAVRNNGGGHANHSLFWTLLSPNGGGEPKGALLDAINSKFGSFEKFKEQFA
AAAAGRFGSGWAWLVVNNGELEITSTPNQDNPLSEGKKPILGLDVWEHAYYLKYQNRRPE
YISAFWNVVNWDEVEKLYEAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacactttaccgcaattgccgtatgcgtatgatgccctggagccttatattgac
aaggaaacgatgaacatccaccatacgaagcaccataatacttatgtcaccaatttgaac
aaagcgttggaaggccatgacgaccttgcttccaaatccgttgaggacttaatttcggat
ttgaatgcggttccggaagaaatccgtacagcggttcgcaacaatggcgggggacatgcc
aaccactcgttgttctggacgttgctttcgccaaatggcggtggcgaaccgaaaggcgca
ctgcttgacgcgatcaacagcaaattcggcagctttgaaaaattcaaagaacaatttgca
gcggctgcagcgggtcgtttcggttccggctgggcatggcttgttgtcaataatggcgag
cttgaaattacaagcaccccgaaccaagacaacccgctttccgaaggcaaaaaaccaatt
cttggccttgatgtttgggaacatgcttactacttgaaataccaaaaccgccgtccggaa
tacatttctgcattctggaatgtcgtgaactgggacgaagtggaaaaactgtacgaagca
gcgaaataa

DBGET integrated database retrieval system