KEGG   Buttiauxella agrestis: BADSM9389_19560
Entry
BADSM9389_19560   CDS       T06676                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bage  Buttiauxella agrestis
Pathway
bage00480  Glutathione metabolism
bage01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bage00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BADSM9389_19560 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bage02000]
    BADSM9389_19560 (gstA)
Enzymes [BR:bage01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BADSM9389_19560 (gstA)
Transporters [BR:bage02000]
 Other transporters
  Pores ion channels [TC:1]
   BADSM9389_19560 (gstA)
SSDB
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C_6
Other DBs
NCBI-ProteinID: BCG09288
LinkDB
Position
complement(2097830..2098432)
AA seq 200 aa
MKLYYKAGACSLSPHIILRETGVDFSLVKVDLAAKKTETGDDYLEVNAKGQVPALVLDDG
SLLTEGVAIVQFLADKVPDRQLLAPAGSMTRYHTLEWLNYIATELHKGFSPLFNPATPDD
FKTLTRAALEKKFKYVNEELNDKQWLMGLRFSVADAYLFTVLRWAQALKLNLEGLSNIDA
FMERMKARPAVAAALTAEGI
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaactgtattataaagctggtgcctgttccctctccccccacatcatcctgcgcgaa
accggtgtagatttctccctcgtcaaagtcgatttagcggcaaagaaaaccgaaacgggt
gacgattatcttgaagtgaatgccaaaggccaggttccggcactggtacttgatgacggt
tcgctgctgactgaaggggttgcgattgtgcagttcctcgcagataaagtgcctgaccgc
cagttgctcgctcccgcaggcagcatgacgcgctaccatacgctcgagtggcttaactac
attgcgacagagcttcacaaaggcttctcgccattatttaatccagcaacgcctgacgat
ttcaaaacacttacgcgtgccgcacttgagaaaaaattcaaatacgtaaacgaagagttg
aatgacaaacagtggctgatgggtctgcgttttagcgtggcggatgcgtatctgtttacc
gtattgcgctgggcacaggcattgaaactcaatctggaagggttgagcaacatcgacgcg
tttatggaacgtatgaaagcgcgtccggcagtggcggcggcgttaacagctgaagggatt
taa

DBGET integrated database retrieval system