KEGG   Brevibacillus agri: BA6348_04805Help
Entry
BA6348_04805      CDS       T05855                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bagr  Brevibacillus agri
Brite
KEGG Orthology (KO) [BR:bagr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BA6348_04805
Enzymes [BR:bagr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BA6348_04805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO K_oxygenase FAD_binding_3 Thi4 Glutaredoxin AlaDh_PNT_C NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: QAV12141
LinkDB All DBs
Position
967113..968642
Genome map
AA seq 509 aa AA seqDB search
MILDAEIKAQLGQYLQLMEGEVLLKYSAGSDSVSRDMMLLLEELATMSQKIKLEETSMQR
TPSFSVNRIGEDTGLTFAGVPLGHEFTSLVLALLQVSGRPPKVDQKLIDQVKSLKGEYHF
ETYVSLSCHNCPDVVQALNAMSVLNPGITHTMIDGAAFKEEVESKNVMAVPTVFLNGEPF
GSGRMTLEEILAKLGSAPDAAEFANKEPYDVLVIGGGPSGASAAIYAARKGIRTGIVAER
FGGQIMDTLGIENFISVKYTEGPKLAASLEEHVKEYNVDVMNLQRAKRLEKKDLIEIELE
NGAVLKSKTVILSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFAGKRVAVIGGGNSGV
EAAIDLAGIVKHVTVLEFAAELKADSVLQDRLHSLPNVTVITNAQTTEITGTDKVNGISY
KDRETETVHHIELEGVFVQIGLVPNTDWLGDTVERNRMGEIVVDKHGATSVPGVFAAGDC
TNSPYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatactggacgcagaaattaaagcgcaactagggcaataccttcagcttatggaaggc
gaagtgctgctgaagtacagcgctggttccgatagcgtatctcgtgacatgatgcttttg
ctggaagaactggcaaccatgtcacagaaaataaagcttgaagaaacctccatgcagcgt
acacctagctttagtgtcaatcgtatcggtgaagataccggattaacttttgcgggcgta
ccattgggacatgagttcacttccttggtgttagctttgctgcaagtgagcggcagacct
ccaaaggttgaccagaagctcatcgatcaagtgaagagtctgaaaggcgaatatcacttt
gaaacgtatgtcagcttgagctgccacaattgtcctgatgtagttcaagcactgaacgcg
atgagtgttctcaatcctggtattacacatactatgattgacggtgctgcgttcaaagaa
gaagtcgaaagcaaaaacgtcatggcagtgccgacggttttcctgaacggggaacctttt
ggcagcggccggatgacgctcgaagaaattctcgccaagctcggatctgctccagatgca
gccgaatttgcgaacaaagagccgtacgatgtgctcgttatcggcggcggcccgtccgga
gcaagtgcggccatctacgccgcacgcaaaggcattcgcaccggcattgtggctgaacgc
ttcggcggccagatcatggacactttgggtattgaaaactttatcagtgtcaaatacacc
gaaggtccgaagctcgcagcgagtctggaagagcacgtcaaagagtacaatgtcgatgtc
atgaacttgcagcgtgccaaacgtctggagaaaaaagacctgatcgagatcgaactggaa
aacggtgctgtgctcaagagcaaaaccgttatcctttcgacgggtgcgcgttggcgcaat
gtgggtgtgcctggcgaggccgagttcaaaaacaaaggcgtggcgtattgcccgcattgc
gacggtccgctgttcgccggtaagcgcgtagccgtcattggcggcggcaattccggcgtt
gaagcagcgatcgatctcgcgggtatcgtcaagcacgtcacggttcttgagtttgctgca
gagctgaaagccgactccgtcttgcaagatcgtctgcacagcttgccaaacgtaacggtt
atcaccaatgcgcaaacgacggaaatcaccggcaccgacaaggtcaacggcatttcctac
aaggatcgcgagacggaaacggttcatcacattgaactggaaggtgtgtttgtccaaatc
ggtcttgtgccgaacaccgattggctgggagacacagtcgaacgcaatcggatgggcgaa
atcgttgtcgacaaacacggcgctacttccgttccgggcgtatttgctgcaggcgactgc
acgaatagtccatacaagcagatcattatttcgatgggatcaggtgcaaccgcagccttg
ggtgcatttgattatctaatccgaaactaa

DBGET integrated database retrieval system