KEGG   Brevibacillus agri: BA6348_20430Help
Entry
BA6348_20430      CDS       T05855                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bagr  Brevibacillus agri
Pathway
bagr00020  Citrate cycle (TCA cycle)
bagr00190  Oxidative phosphorylation
bagr00650  Butanoate metabolism
bagr01100  Metabolic pathways
bagr01110  Biosynthesis of secondary metabolites
bagr01120  Microbial metabolism in diverse environments
bagr01130  Biosynthesis of antibiotics
bagr01200  Carbon metabolism
Module
bagr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bagr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bagr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BA6348_20430
   00650 Butanoate metabolism
    BA6348_20430
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BA6348_20430
Enzymes [BR:bagr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BA6348_20430
    1.3.5.4  fumarate reductase (quinol)
     BA6348_20430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_18 Fer4_2 Fer4 Fer4_16 Fer4_20 Fer4_13 Fer4_4 Fer4_15 Fer4_3 Fer4_21 Fer4_6
Motif
Other DBs
NCBI-ProteinID: QAV14918
LinkDB All DBs
Position
complement(4171101..4171850)
Genome map
AA seq 249 aa AA seqDB search
MAEKLIHLIITRQDSPDSTPYKEEFKIPYRPGMNVIGALMEIQRNPLNAQGQKTSPVNWE
SNCLEEVCGACSMVINGRPRQACSALIDKLEQPIRLEPMSTFPVQRDLSIDRSRMFDALK
RVKAWIPIDGTHDLGPGPRMPEVERQWAYELSKCMTCGVCLEACPNVNAKSEFIGPFAIS
QVRLFNQHPTGMMNKHERLEALMEDGGIGDCGNSQNCVQACPKGIPLTTSIAHMNKETTK
HAVKKFFFS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaattgattcacctgattattactcgccaagacagccctgacagcactcca
tacaaggaagagttcaaaatcccgtaccgtcctggtatgaacgtcattggtgcgctgatg
gagattcaacgcaatccgctcaacgcgcaaggccaaaaaacttctccggtcaactgggaa
tcgaactgcttggaagaagtatgcggcgcgtgctcgatggtcatcaacggaagaccgcgc
caggcttgctcggcgctgatcgataaactggaacagccaattcgtctggagccaatgagc
acgttccctgtacaacgcgacttgtcgattgaccgtagccgcatgttcgatgcgttgaaa
cgtgtaaaagcatggattccaatcgatggtacgcatgatctgggaccaggtccgcgcatg
ccggaagtagagcgtcaatgggcgtacgagctgtccaagtgcatgacgtgcggggtatgc
ttggaggcttgcccgaacgtgaacgcgaagtccgagttcattggaccgtttgcgatttcc
caggttcgcctgttcaaccagcatccaactggtatgatgaacaagcatgagcgtctggaa
gctctgatggaagacggcggtatcggcgattgcggtaactcgcaaaactgcgtgcaagct
tgtccaaaaggcatcccgctcacgacctcgattgctcacatgaacaaagaaacgaccaaa
catgcggtgaagaaattcttcttctcctaa

DBGET integrated database retrieval system