KEGG   Brevibacillus agri: BA6348_20435Help
Entry
BA6348_20435      CDS       T05855                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bagr  Brevibacillus agri
Pathway
bagr00020  Citrate cycle (TCA cycle)
bagr00190  Oxidative phosphorylation
bagr00650  Butanoate metabolism
bagr01100  Metabolic pathways
bagr01110  Biosynthesis of secondary metabolites
bagr01120  Microbial metabolism in diverse environments
bagr01130  Biosynthesis of antibiotics
bagr01200  Carbon metabolism
Module
bagr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bagr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bagr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BA6348_20435
   00650 Butanoate metabolism
    BA6348_20435
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BA6348_20435
Enzymes [BR:bagr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BA6348_20435
    1.3.5.4  fumarate reductase (quinol)
     BA6348_20435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: QAV14919
LinkDB All DBs
Position
complement(4171869..4173626)
Genome map
AA seq 585 aa AA seqDB search
MAKGKLIIVGGGLAGLMATIKAAEKGVPVQLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
STWEHFDDTVYGGDFLANQPPVKAMCDAAPGIIYMLDRMGVMFNRTPEGLLDFRRFGGTK
HHRTAFAGATTGQQLLYALDEQVRRYEAEGLVTKYEYWDFLGAVLDETGTCRGITAQNMR
SGEIQSFRADAVILATGGPGIIFGKSTNSIINTGTAASAAYQQGVIYANGEMIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFSVCVDMK
LGVNGENMVYLDLSHKDPKELDVKLGGIIEIYEKFVGDDPRKVPMKIFPAVHYSMGGMWV
DYNQMTNIPGLFAAGECDYSQHGANRLGANSLLSAIYGGMVAGPKAIEYIKGLNQSSDDL
SSTLFDSYTSKEQAKYDSILKMDGTENAYLIHKELGEWMTDNVTVVRYNDRLQKTDEKIQ
ELMERYKKININDTSKWSNAGASFTRHLWNMLVLSRAITIGALMRNESRGAHYKPEFPER
DDENFMKTTMAKFNPETTAPEIYYEDIDVSLIPPRKRDYTSDKKH
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaacttatcattgtcggtggtggattggccggcttgatggctactatc
aaagctgcagaaaaaggcgttcccgttcagttgttctccctggttccggtaaaacgttcc
cactctgtttgtgcgcagggcggtatcaacggtgcggtaaataccaaaggggaaggcgac
tccacatgggagcacttcgacgatacagtttacggtggagacttcttggcaaaccaacca
ccagtaaaagcaatgtgcgatgcagcacctggaattatctatatgcttgaccggatgggc
gtcatgttcaaccgcacaccagaaggtctgttggacttccgccgtttcgggggaacaaaa
catcaccgtactgcgtttgcaggtgcgacaaccggacaacaactgctgtacgcgctggac
gagcaagtacgccgctacgaagcagaaggtctggttaccaagtacgaatattgggatttc
ctcggagccgttttggacgagacaggaacctgtcgcgggattaccgcgcaaaacatgcgt
tccggtgaaattcaatccttccgtgcagatgccgttattttggcaacaggcggccctggt
atcatcttcggtaaatcgaccaactcgatcatcaacacaggtacagcagcgtctgccgct
taccagcaaggcgtaatctacgccaacggtgagatgatccagattcacccgactgcgatt
ccgggcgacgacaagctgcgtctgatgtctgaatccgcgcgcggtgagggcggtcgcgta
tggacgtacaaagacggtaagccttggtacttcctggaggaaaaatatcctgcctacgga
aacctggtaccgcgtgatattgcgactcgcgaaatcttctctgtctgcgtagacatgaaa
ctgggcgtcaacggcgaaaacatggtgtacctcgatctgtcccacaaagatccgaaagag
ctggatgtaaaactgggcggtattatcgagatttacgaaaaattcgtaggggatgacccg
cgcaaagtgccgatgaagattttccctgccgttcactactccatgggcggaatgtgggta
gactacaaccaaatgaccaacatccctggtctgtttgcagcgggtgagtgcgattactcc
cagcacggcgcgaaccgtttgggtgcaaactccctgttgtccgcgatctacggcggtatg
gttgccggtccaaaagcgatcgagtacatcaaaggcttgaatcaatcttcggatgatctg
tcttctactctctttgacagctacacgagcaaagaacaggcgaaatacgacagcattttg
aaaatggacggaacggaaaatgcttacctgatccacaaggagctgggtgagtggatgaca
gacaacgtaacggtagttcgttacaacgaccgtctgcaaaaaacagatgaaaagattcaa
gagttgatggagcgctacaaaaaaatcaacatcaacgatacaagcaaatggagcaacgca
ggtgcttccttcactcgtcacttgtggaacatgctcgtcctctcccgtgcgatcacaatc
ggtgcgctcatgcgtaacgagagccgcggcgctcactacaaaccggaattccctgagcgt
gatgacgagaacttcatgaagacaactatggcgaagttcaatccggaaacaaccgcgcca
gaaatctactacgaagacatcgatgtttcgttgatcccgccacggaaacgtgactatacg
tctgacaagaagcattaa

DBGET integrated database retrieval system