KEGG   Bacillus anthracis CDC 684: BAMEG_0273Help
Entry
BAMEG_0273        CDS       T00886                                 

Definition
(GenBank) putative D-ala D-ala ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00473  D-Alanine metabolism
bah00550  Peptidoglycan biosynthesis
bah01100  Metabolic pathways
bah01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAMEG_0273
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAMEG_0273
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BAMEG_0273
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bah01011]
    BAMEG_0273
Enzymes [BR:bah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BAMEG_0273
Peptidoglycan biosynthesis and degradation proteins [BR:bah01011]
 Precursor biosynthesis
  Amino acid ligase
   BAMEG_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_N
Motif
Other DBs
NCBI-ProteinID: ACP17356
LinkDB All DBs
Position
232346..232822
Genome map
AA seq 158 aa AA seqDB search
MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITEQGQWIRGERIEGEVA
NVEVLKMSGAENAISPLSLSTEIIPSANAEENAIDVIFPLLHGPNGEDGTVQGLLELMNI
PYVGNGVLASAAGMDKVVMKNIFAEAGLKTSEICIIHS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaattaaattaggtttattatatggtggaaaatcagctgagcatcaagtttcg
ttacaaacggctcttgctgctattaaagcattaaatcaagataaattcgagattcatcca
atttatattacagaacaaggtcaatggatacgcggtgaacgtattgaaggtgaagtagca
aatgttgaagttctaaaaatgagcggtgcagaaaatgcgatttctccgttatctttaagc
acagaaatcattccatctgcaaatgctgaggaaaatgctatcgacgttattttcccatta
ctacatggaccaaatggtgaagatggaacggttcaaggtttattagaattaatgaacatt
ccttatgtaggaaatggtgttctagcatctgctgctggtatggataaagttgttatgaaa
aacattttcgcagaagctggattaaaaacaagcgaaatatgcatcattcattcgtag

DBGET integrated database retrieval system