KEGG   Bacillus anthracis CDC 684: BAMEG_0380Help
Entry
BAMEG_0380        CDS       T00886                                 

Gene name
gatA
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00970  Aminoacyl-tRNA biosynthesis
bah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bah00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAMEG_0380 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bah03029]
    BAMEG_0380 (gatA)
Enzymes [BR:bah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BAMEG_0380 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BAMEG_0380 (gatA)
Mitochondrial biogenesis [BR:bah03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAMEG_0380 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACP12918
UniProt: C3L559
LinkDB All DBs
Position
327275..328732
Genome map
AA seq 485 aa AA seqDB search
MSLFDHSVSELHKKLNNKEISVTDLVEESYKRIADVEDNVKAFLTLDEENARAKAKELDA
KIGAEDNGLLFGMPIGVKDNIVTNGLRTTCASKILANFDPIYDATVVQKLKAADTITIGK
LNMDEFAMGSSNENSGFYATKNPWNLDYVPGGSSGGSAAAVAAGEVLFSLGSDTGGSIRQ
PAAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAYLLQAISGLDRMDATSA
NVEVGNYLAGLTGDVKGLRIAVPKEYLGEGVGEEARESVLAALKVLEGMGATWEEVSLPH
SKYALATYYLLSSSEASANLSRFDGVRYGVRSDNVNNLMDLYKNTRSEGFGDEVKRRIML
GTFALSSGYYDAYYKKAQQVRTLIKNDFENVFANYDVIIGPTTPTPAFKVGEKVDDPMTM
YANDILTIPVNLAGVPAISVPCGFGANNMPLGLQIIGKHFDEATIYRVAHAFEQATDHHT
KKASL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcattatttgatcattcagtatcagagttacataagaagttaaacaacaaagaaatt
tccgttacggatttagtagaagaatcttacaaacgtattgcggatgttgaagataacgta
aaagcttttcttacattagatgaagaaaacgcacgcgcgaaagcgaaagaattagacgca
aaaattggcgctgaagataatggtttattatttggtatgccaatcggtgttaaagataac
attgtaactaacgggcttcgtacaacttgtgcgagcaaaatattagcaaacttcgatcca
atttatgatgcgacagttgtgcaaaagctaaaagctgctgacacaattacaatcggtaaa
ttaaatatggatgagttcgcaatgggttcttcaaatgaaaactcaggtttctacgctacg
aaaaatccatggaacttagattacgttccaggcggatctagtggtggttctgcagcagct
gtagcagcaggagaagtattattctctctaggttctgatacgggtggttctatccgtcag
ccagctgcatattgcggcgttgtaggtttaaaaccaacttacggacgcgtatctcgttac
ggattagtagcattcgcatcttcacttgaccaaatcggaccgattacacgtacagtagaa
gacaatgcatacttattacaagctatttcaggccttgaccgtatggatgcaacttctgca
aacgttgaagtaggaaactacttagctggtttaacaggcgacgttaaaggtttacgcatt
gctgtaccgaaagaatacttaggtgaaggtgttggcgaggaagcccgtgagtcagtgcta
gctgctttaaaagtattagaaggtatgggcgcaacttgggaggaagtatctcttccacac
tctaaatacgctctagcaacgtattacttactatcttcttctgaagcatctgctaacctt
tcacgcttcgacggcgtacgttacggcgttcgttctgacaatgtgaataacttaatggat
ctttacaaaaacacacgtagcgaaggcttcggtgatgaagttaaacgtcgtattatgctt
ggtacatttgcacttagctctggttactatgatgcatattacaaaaaggcacaacaagta
cgtacattaattaaaaacgactttgaaaatgtatttgctaactacgatgttattattgga
ccaactacgccaactccggcatttaaagtgggcgaaaaagttgatgatccaatgacaatg
tatgcaaatgacattttaacaatcccagtaaacttagcgggtgttccagcgatttctgtt
ccatgtggattcggtgctaacaacatgccacttggtctacaaatcattggtaaacacttc
gatgaagcgacaatttaccgcgttgcacatgcgtttgagcaagcaacagaccatcataca
aaaaaagcaagtctgtaa

DBGET integrated database retrieval system