KEGG   Bacillus anthracis CDC 684: BAMEG_3358Help
Entry
BAMEG_3358        CDS       T00886                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00061  Fatty acid biosynthesis
bah00780  Biotin metabolism
bah01100  Metabolic pathways
bah01130  Biosynthesis of antibiotics
bah01212  Fatty acid metabolism
Module
bah_M00083  Fatty acid biosynthesis, elongation
bah_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BAMEG_3358 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAMEG_3358 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BAMEG_3358 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bah01004]
    BAMEG_3358 (fabI)
Enzymes [BR:bah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BAMEG_3358 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BAMEG_3358 (fabI)
Lipid biosynthesis proteins [BR:bah01004]
 Fatty acid synthase
  Component type
   BAMEG_3358 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ACP14315
LinkDB All DBs
Structure
PDB: 

Position
complement(3048008..3048778)
Genome map
AA seq 256 aa AA seqDB search
MELLQGKTFVVMGVANQRSIAWGIARSLHNAGAKLIFTYAGERLERNVRELADTLEGQES
LVLPCDVTNDEELTACFETIKQEVGTIHGVAHCIAFANRDDLKGEFVDTSRDGFLLAQNI
SAFSLTAVAREAKKVMTEGGNILTLTYLGGERVVKNYNVMGVAKASLEASVKYLANDLGQ
HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRTTTQEEVGDTAVFLFSDLARG
VTGENIHVDSGYHILG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaactattacaagggaaaacatttgttgttatgggcgttgcgaaccaaagaagtatt
gcatggggaattgctcgctctttgcataatgcaggtgcaaaattaatcttcacatatgca
ggagaacgtttagagagaaatgttcgtgaattagcggatacattagaaggacaagaatca
cttgtattaccttgtgatgtaacaaatgatgaagaacttacagcttgttttgaaacaatt
aagcaagaagttggtacaattcacggtgttgcacactgtattgcttttgcaaatcgtgac
gacttaaaaggtgaatttgtagatacttctcgcgatggatttttacttgcacaaaatatt
agtgcattctctttaacagctgtagcaagagaagcgaagaaagtaatgacagaaggcgga
aatattttaacgttaacatatcttggcggcgagcgcgttgtgaaaaactataacgttatg
ggtgttgcgaaagcttcattagaagcgagcgtgaaatatttagctaacgatttaggccaa
cacggcattcgcgttaacgctatttctgcaggtccaattcgtacgttatctgccaaaggt
gtaggcgactttaactcaatcttaagagaaattgaggagcgcgcaccacttcgtcgtaca
acaacgcaagaagaagttggggatacagcagtattcttattcagtgatttagcacgcggc
gtaacaggagaaaacattcacgttgattcagggtatcatatcttaggataa

DBGET integrated database retrieval system