KEGG   Bacillus anthracis CDC 684: BAMEG_3543Help
Entry
BAMEG_3543        CDS       T00886                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase, aerobic
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00564  Glycerophospholipid metabolism
bah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAMEG_3543 (glpD)
Enzymes [BR:bah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BAMEG_3543 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 FAD_oxidored GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACP13547
LinkDB All DBs
Position
complement(3220134..3221816)
Genome map
AA seq 560 aa AA seqDB search
MKFSSKQRKDVLNGVNKQELDVIVIGGGITGSGIALDGATRGLSTIVFEMQDFAAGTSSR
STKLVHGGLRYLKQLEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHTGGTFGSFSTSI
GLRVYDFLAGVKRSERRKMFNREETLKKEPLVKQEGLKGGGYYVEYRTDDARLTIEVMKE
AIEHGAKAVNYAKVDGFLYKDGKVCGVRVIDLLDGEVYEVYGKKIVNAAGPWVDTLREKD
NSKKGKVLQLSKGVHLVIDQKRFPLGQAIYFDTPDKRMVFAIPRGGKTYVGTTDTFYDKD
AAVPQMTTEDRTYIINAINYMFPSVKITEKDIESSWAGVRPLIYEEGKSASEISRKDEIW
TSESGLITIAGGKLTGYRKMAEMVVDYVTNLLQKEGHSAYPKSSTKHMPISGGHVDGSKG
LPAFIAKKAGEGTKYGLTTAQAEEFAKFYGSNVDVPFDLAKKHKDEAKEYNMPLDVLIPL
VYAMDYEMTAKPVDFFVRRRGAVFFNIHWVYEWKEAVINYMAAKLGWSKEEQMKYTAELE
KALTDAVIPVDQQEHAAALA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcaagtaaacaacgtaaagacgtattaaacggagtaaataaacaagaatta
gatgtgatcgtaattggtggaggtattactggttctggtattgcattagatggagcaaca
cgcgggttatcaacaattgtgtttgaaatgcaggactttgcagcaggtacatcaagtcgt
tcaacgaagcttgtacacggtggtctacgttatttaaaacaacttgaagtgaaaatggta
gcagaggtgggtaaagagcgtgcgatcgtatatgagaacggtccccatgtaacaacacca
gagtggatgttacttccgttccatacaggaggtacgttcggatcatttagtacatcaatt
ggtcttcgtgtatacgacttcttagcaggtgtaaaacgaagtgagcgcagaaaaatgttt
aaccgtgaagaaacgctgaagaaagagcctcttgtaaaacaagaaggattaaaaggtggc
ggttactacgtagaatatcgtacagacgatgcacgtcttacaattgaagtaatgaaagaa
gcaattgagcacggcgcaaaagctgttaattacgcaaaagtagacggtttcttatataaa
gatggaaaagtatgtggtgtacgtgtaatcgatttactagacggagaagtatacgaagtt
tacggtaagaaaattgtaaacgcagctggtccttgggtagatacacttcgtgaaaaagat
aactcgaaaaaaggaaaagtacttcagttatcaaaaggtgttcacttagtaattgatcaa
aaacgtttcccattaggtcaagcgatttacttcgatacaccagataaacgtatggtattc
gcgattccacgcggcggaaaaacatacgtaggtacaacagatacgttctatgataaagac
gcagctgtaccacaaatgacaacagaagatcgcacgtacatcattaatgcgattaactac
atgttcccaagcgtaaaaattacggaaaaagacatcgaatcaagctgggctggtgtacgt
ccgttaatttacgaagaaggtaagagtgcatctgaaatttctcgtaaagacgaaatttgg
acttctgaatctggtttaattacaatcgcaggtggtaaattaacaggataccgcaaaatg
gctgaaatggtagtagactacgtaacgaacttactacaaaaagaaggtcacagtgcatat
ccgaagagctcaacgaaacatatgccaatctctggtggacatgtagatggctctaaaggg
ttaccagcatttatcgcgaaaaaagcaggcgaaggtacgaaatacggtttaacaacagca
caagcagaagaattcgcgaaattctatggctctaacgttgacgtaccattcgacttagca
aaaaaacataaagacgaagcgaaagaatacaacatgccactagacgttctaatcccactt
gtatacgcaatggattacgaaatgacagcaaaaccagtcgacttcttcgtacgccgcaga
ggcgctgtattcttcaacatccactgggtatacgagtggaaagaagcagtaatcaactac
atggctgcgaaactaggctggagcaaagaagaacaaatgaaatacacagctgaattagag
aaagcattaacagacgctgtcattcctgtagatcaacaagaacatgcagctgcgttagcg
taa

DBGET integrated database retrieval system