KEGG   Bacillus anthracis CDC 684: BAMEG_4671Help
Entry
BAMEG_4671        CDS       T00886                                 

Gene name
relA
Definition
(GenBank) GTP diphosphokinase
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00230  Purine metabolism
bah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BAMEG_4671 (relA)
Enzymes [BR:bah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     BAMEG_4671 (relA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 HD ACT DUF1444 ThiS DNA_pol3_gamma3
Motif
Other DBs
NCBI-ProteinID: ACP16740
LinkDB All DBs
Position
complement(4213239..4215422)
Genome map
AA seq 727 aa AA seqDB search
MANEQVLTAEQVLEKASQYLVDEDIELVARAYEYARDAHSEQYRKSGEPYIIHPIQVAGV
LVDLHMDPATVSAGFLHDVVEDTEITLEDIEREFNKEIAMLVDGVTKLGKIKYKSHEQQQ
AENHRKMFIAMAQDIRVILIKLADRLHNMRTLKHLPQEKQRRIANETLEIFAPLAHRLGI
STIKWELEDTSLRYLNPQQYYRIVNLMKRKRAEREEYLDEVMTGIREKLDEVAIQPEISG
RPKHIYSIYRKMALQNKQFNEIYDLLAVRVVVNSIKDCYAVLGIIHTCWKPMPGRFKDYI
AMPKANLYQSLHTTVIGPKGDPLEVQIRTKEMHEIAEFGIAAHWAYKEGKTAETTGTLEK
KLTWFRQILEWQNEASNAEEFMESLKIDLFSDMVFVFTPKGDVMELPLGSVPIDFAYRVH
SEIGNKTIGAKVNGKMVTLDYKLKTGDIIEILTSKHSYGPSQDWVKLAQTSHAKNKIRQF
FKKQRRDENIEKGRELVEKEVRSLEYEMKEVLAPDNLKRVAEKFNFANEEDMFAAVGYNG
ITASQIVTRLTDKFRKQREEEEIVEVKEVRKPMKIRKWDSGVKVSGADNLLIRLSKCCNP
VPGDDIVGYITKGRGVSIHRRDCVNVHTEEAIERLLEVEWEGSPEKEIEYNVDIEISGYD
RRGLLNEVLQAVTETKTYISAVSGRSDRNKMATINMSISIRNLQHLKKVVERIKRVPEIY
AVRRMMH
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgagcaggtactaacagctgaacaggtactcgagaaagcaagtcaatattta
gtggatgaagatattgagctagtagcacgtgcctatgaatatgcacgcgatgcacatagc
gaacaatacagaaaatcgggtgaaccgtacattattcatccaattcaagttgcaggtgtt
ttagttgatttacacatggatccagctacagtatcagcaggtttcttacatgatgtagta
gaagatacagagattacattagaagatattgaacgggaatttaataaagaaattgctatg
cttgtcgatggtgtgacaaagctcggaaagattaaatataaatctcatgagcaacaacaa
gcagaaaaccatcgcaaaatgtttattgcaatggctcaagatattcgagttattttaatt
aaactagctgatcgtcttcataacatgcgtacattgaaacatttgcctcaagagaagcag
cgtcgcattgcgaatgaaacgttagaaatctttgcacctttggcacatagactcggaatt
agtactattaaatgggagctagaggatacgtcacttcgctatttaaatccacagcaatat
tatcgtattgtaaatttaatgaagcgtaaacgtgcagaacgtgaagagtatttagacgaa
gtaatgactggtattcgtgagaaattagacgaagttgcaattcaaccagagatttctgga
agaccaaaacatatttacagtatttatcgtaaaatggcactgcaaaataaacagttcaat
gaaatttacgatttattagctgtacgtgtcgttgtaaatagtattaaagattgttatgca
gtacttggaattattcatacgtgctggaagccgatgccaggtcgttttaaggattatatt
gcaatgccgaaagcaaatctatatcaatctcttcatacgactgtaattggaccgaaaggt
gatccgcttgaagtgcaaattcgtacgaaagaaatgcatgagattgcagaattcgggatc
gcggcacactgggcgtataaagaaggaaaaacagcagaaacaacaggtacattagagaag
aaacttacatggttccgtcaaatattagaatggcaaaatgaagcttctaatgcagaagag
tttatggagtcgttaaaaattgatttattctctgacatggtattcgtctttacaccgaaa
ggcgatgtaatggaattgccacttggatctgttccaattgactttgcatatcgtgtgcat
tcagagattgggaataaaacaattggtgcaaaagtaaacgggaaaatggtgacacttgac
tataaattaaaaacaggtgacatcattgaaattttaacatcgaaacattcgtatggacca
agtcaagattgggtgaaactagctcaaacatctcatgcaaaaaacaaaatacgtcaattc
tttaagaagcaacgtagagatgaaaatattgaaaaaggccgtgaacttgttgagaaagaa
gtgcggagcctagagtatgagatgaaagaagtgttagctcctgacaatttaaaacgtgtt
gctgaaaaattcaactttgcaaatgaagaagatatgtttgcagcagttggatataatggc
atcactgcatcacaaattgttacgcgactaacggacaagttccgtaagcaacgtgaagaa
gaagagattgttgaagttaaagaagttcgtaaaccgatgaaaattcgaaaatgggattct
ggcgttaaagtgagcggtgcggataatttattaattcgtttatcaaaatgctgtaaccca
gtacctggtgatgatatcgttggatatattacgaaaggccgaggcgtatcaattcaccgc
cgtgattgtgtaaatgttcatacagaagaagcgatagaacgtttattagaagtagagtgg
gaaggtagtcctgaaaaagaaattgagtataacgttgatattgaaatttcaggttacgat
cgccgtggtttattaaacgaagtattacaagctgttacagagacgaaaacgtacatttca
gcagtttctggtagaagtgaccgtaataagatggcgacaattaatatgtcaatctctatt
cgtaacttacagcacttgaaaaaagtagtagaacgcattaaacgtgttccagaaatttat
gcagtacgacgcatgatgcattaa

DBGET integrated database retrieval system