KEGG   Bacillus anthracis A0248: BAA_2237
Entry
BAA_2237          CDS       T00892                                 

Gene name
argS1
Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bai00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAA_2237 (argS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bai01007]
    BAA_2237 (argS1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bai03016]
    BAA_2237 (argS1)
   03029 Mitochondrial biogenesis [BR:bai03029]
    BAA_2237 (argS1)
Enzymes [BR:bai01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BAA_2237 (argS1)
Amino acid related enzymes [BR:bai01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BAA_2237 (argS1)
Transfer RNA biogenesis [BR:bai03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BAA_2237 (argS1)
 Prokaryotic type
   Other AARSs
    BAA_2237 (argS1)
Mitochondrial biogenesis [BR:bai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAA_2237 (argS1)
SSDB
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N UNC45-central
Other DBs
NCBI-ProteinID: ACQ46444
LinkDB
Position
2024589..2026277
AA seq 562 aa
MDYKTQFAESLSNIFTNELTQQQILDLIETPKQDEFGDAAFPCFSLAKQYKKSPAIIAKE
VAEKLSDPFFTKVEAVGPYVNVFFNRDTVSDAVLKTILAEKEEYGKNYFGCEKTVVIDYS
SPNIAKPFSMGHLRSTMIGNSLKHIAEKCGYEVVGINYIGDWGTQFGKLITAYKKWGNEA
VVKEDPIRELFKLYVQFHEEVKDDEELEEEGRAWFKKLEEGDEEAVELWNWFRHESLKEF
SRIYELLGVEFTNFQGEAFYNNLMEDFIGILEEHDLLEESEGALVVNLEEEGMPPCLIRK
SDGATIYATRDLTAALYRQNTFGFDKALYVVGPEQSLHFNQFFTVLKKLGYTWVDGMEHV
PFGFILKDGKKMSTRKGRVILLEEVLEEAIELAKQNIEEKNPNLKQKEEVAKQVGAGAVI
FHDLKNERMHNIEFSLENMLKFEGETGPYVQYTHARACSILRKESVEFETCTFALKDDHS
WSVVKLLNKFPQVIEIAFNKNEPSVISKYVLDVAQSFNKYYGNVRILEESEEKDSRLALV
YAVTVVLKEGLRLLGVEAPEEM
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggattataaaacgcagtttgcggaaagtttatctaatatttttacgaatgaattaacg
caacagcaaattttagatttaattgaaacaccgaaacaagatgaatttggagatgctgca
tttccgtgtttttcacttgcgaagcaatataaaaaatcaccagctattatcgcaaaggaa
gttgcagagaaattaagtgatccgttttttacgaaagtagaggctgttggtccttatgta
aatgtattttttaatcgtgatacagtaagtgatgcagtattaaaaacgattttagcggag
aaagaagagtacggtaaaaattattttggatgtgaaaaaacggtcgttatcgattattcc
tcacctaatatcgcgaaacctttttcaatggggcatttacgttctacaatgattggaaat
tcattgaagcatatcgctgaaaaatgtgggtatgaagttgtaggaattaattatattgga
gactggggaacacagtttggaaagttaattacggcttataaaaaatggggaaatgaagca
gtagtgaaagaggatccaatacgtgaattatttaagttatatgttcaatttcatgaagag
gtaaaagacgacgaagaattagaagaagaaggacgcgcttggtttaagaaattagaagaa
ggtgatgaagaagctgttgaactttggaattggttccgccacgaatccttaaaagaattt
tctcgtatttatgaacttctcggtgtggaatttactaattttcaaggagaagctttttat
aataatttaatggaagactttattgggattttagaggaacatgatttacttgaagagtca
gaaggtgcattagtcgttaatttagaagaagagggcatgccaccttgcttaattagaaaa
tcagatggtgcgacgatttacgcaacgcgtgacttaacggcagctctatatcgtcaaaac
acatttggttttgataaagcgttatacgtagttggcccagaacaaagtttacacttcaat
caattcttcactgtattaaaaaagctcggctacacttgggttgatggcatggaacatgta
ccgtttgggttcattttaaaagacggtaagaaaatgtccacacgtaaaggaagagttatt
ttacttgaagaagtacttgaggaagcaatcgaacttgcaaaacaaaatattgaagagaaa
aatccaaacttgaaacagaaagaagaagtagcaaagcaagtcggcgctggcgcagtcatc
ttccacgatttaaaaaatgagcgtatgcacaatattgaattctcattagaaaatatgctg
aaattcgaaggggaaacaggcccgtacgtacaatacacacatgcacgtgcttgctctatt
ttaagaaaagaaagtgtagaatttgaaacgtgtacatttgcattaaaagatgatcatagc
tggagtgttgtaaaattactcaataaattcccacaagtaattgaaatagccttcaacaaa
aatgaaccatcggttatttcgaaatacgtattagatgtagcgcaatcgtttaataaatat
tacgggaatgtgcgtatattagaagagagtgaagagaaagacagtagactggcattagtg
tatgctgtgacggttgtattaaaagaggggttacgtttacttggggtggaggcacctgag
gagatgtaa

DBGET integrated database retrieval system