KEGG   Bacillus anthracis A0248: BAA_4006
Entry
BAA_4006          CDS       T00892                                 

Gene name
rpsP
Definition
(GenBank) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
bai  Bacillus anthracis A0248
Pathway
bai03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bai00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BAA_4006 (rpsP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bai03011]
    BAA_4006 (rpsP)
   03029 Mitochondrial biogenesis [BR:bai03029]
    BAA_4006 (rpsP)
Ribosome [BR:bai03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BAA_4006 (rpsP)
  Bacteria
    BAA_4006 (rpsP)
Mitochondrial biogenesis [BR:bai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAA_4006 (rpsP)
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: ACQ47202
UniProt: C3P5P5
LinkDB
Position
complement(3658278..3658550)
AA seq 90 aa
MAVKIRLKRMGAKKTPFYRVVVADSRSPRDGRFIEEIGTYNPVAQPAEVKINEEAALKWL
GNGAKPSDTVRNLFSNQGIMEKFHLSKQGK
NT seq 273 nt   +upstreamnt  +downstreamnt
atggcagttaaaattcgtttaaaacgtatgggagctaaaaaaactcctttctatcgtgta
gttgttgcagattctcgttctcctcgtgacggacgtttcattgaggaaatcggtacttac
aatccggttgctcaaccagctgaagttaagatcaacgaagaagcagcattaaaatggtta
ggaaatggtgctaaaccatctgatacagttcgtaacttattctctaaccaaggtatcatg
gagaaattccacttatctaaacaaggtaagtaa

DBGET integrated database retrieval system