KEGG   Bacillus anthracis A0248: BAA_4088
Entry
BAA_4088          CDS       T00892                                 

Gene name
rpmF
Definition
(GenBank) 50S ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
bai  Bacillus anthracis A0248
Pathway
bai03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bai00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BAA_4088 (rpmF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bai03011]
    BAA_4088 (rpmF)
   03029 Mitochondrial biogenesis [BR:bai03029]
    BAA_4088 (rpmF)
Ribosome [BR:bai03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BAA_4088 (rpmF)
  Bacteria
    BAA_4088 (rpmF)
Mitochondrial biogenesis [BR:bai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAA_4088 (rpmF)
SSDB
Motif
Pfam: Ribosomal_L32p zf-ribbon_3 DZR HypA MqsA_antitoxin Zn-ribbon_8 GATA zf_C2H2_13
Other DBs
NCBI-ProteinID: ACQ45987
UniProt: C3P693
LinkDB
Position
complement(3744833..3745006)
AA seq 57 aa
MAVPFRRTSKTVKRKRRTHFKLSVPGMVECPSCGEAKLAHRVCKACGTYKGKEVISK
NT seq 174 nt   +upstreamnt  +downstreamnt
atggctgtaccttttagaagaacttctaaaacagtaaaaagaaagcgtcgtacgcatttc
aaattatcagtacctggtatggtagagtgcccaagctgtggtgaagcgaaattagctcac
cgtgtatgtaaagcatgcggtacttacaaaggtaaagaagtaatcagcaagtaa

DBGET integrated database retrieval system