KEGG   Bacillus anthracis A0248: BAA_4407Help
Entry
BAA_4407          CDS       T00892                                 

Gene name
yqiS
Definition
(GenBank) phosphate butyryltransferase
  KO
K00634  phosphate butyryltransferase [EC:2.3.1.19]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00650  Butanoate metabolism
bai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAA_4407 (yqiS)
Enzymes [BR:bai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     BAA_4407 (yqiS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB CW_binding_2 DNA_III_psi
Motif
Other DBs
NCBI-ProteinID: ACQ48293
LinkDB All DBs
Position
complement(4002475..4003374)
Genome map
AA seq 299 aa AA seqDB search
MKLEHLIDQAAGQPKKTVAVAVAEDHEVIEAVAKAITLQLAQFRLYGNQEKIMGMLQEHS
LQTSEHIEVIAAQSSAEAAELSVKAVRNGEADVLMKGNIPTANILKAVLNKEWGLRKGSV
LSHVATFEVPNYNRLIFVTDAAMNIAPDVTQKAAIIQNTVEVARAIGIDLPKVAPIAAVE
VVNPAMQATIDAAMLTQMNRRGQIKNCVVDGPLALDNAVSQIAAEHKGIVSDVAGKADIL
LVPTIEAGNVLYKSLVYFADAKVGAMIAGAKAPIVLTSRADSAETKVYSLALAVATASK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagaacacttaattgatcaagcggcaggacagcctaaaaaaactgtggctgta
gcagtagctgaagatcatgaagtaattgaagctgtagcgaaagcaattacattacagcta
gctcaatttcgtctatatggaaatcaagaaaaaataatggggatgctacaagaacatagt
ttacaaacttcagaacatattgaagtgattgcagcacagtcaagtgctgaggctgcagaa
ctttctgttaaagctgtaagaaatggcgaagcagatgtgcttatgaaggggaacatccca
acagcaaatattttgaaagctgtattaaataaagagtggggacttcgtaaaggtagcgta
ctttcacacgttgcaacatttgaagttccaaactacaatcgtctcatttttgttacagat
gcagcgatgaacattgcacctgatgtaacacaaaaagctgctattatacaaaatactgta
gaagttgcccgggcaataggaattgatttgccaaaggtagcaccaattgcagcggtagag
gttgtgaatcctgcgatgcaagcgacaattgatgcagcgatgttaactcaaatgaatcgc
cgcggacaaattaaaaattgtgtcgttgatggaccacttgctttagataatgcagtatca
caaattgcagcagaacataaaggcatagtaagtgatgtagcaggtaaggcagacatttta
ctcgtcccaacaattgaagctggaaatgtgctatataaatcactcgtatactttgcggat
gcaaaagtaggagcaatgattgctggcgcaaaagcaccgattgttttaacatctcgtgct
gattcagcagaaacaaaagtatattcattagcattggcagttgccactgcttcaaaataa

DBGET integrated database retrieval system