KEGG   Bacillus anthracis A0248: BAA_4544
Entry
BAA_4544          CDS       T00892                                 

Gene name
era
Definition
(GenBank) GTP-binding protein Era
  KO
K03595  GTPase
Organism
bai  Bacillus anthracis A0248
Brite
KEGG Orthology (KO) [BR:bai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bai03009]
    BAA_4544 (era)
   03029 Mitochondrial biogenesis [BR:bai03029]
    BAA_4544 (era)
Ribosome biogenesis [BR:bai03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   BAA_4544 (era)
 Prokaryotic type
  GTPases
   BAA_4544 (era)
Mitochondrial biogenesis [BR:bai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAA_4544 (era)
SSDB
Motif
Pfam: MMR_HSR1 KH_2 GTP_EFTU FeoB_N Dynamin_N RsgA_GTPase AIG1 PduV-EutP cobW MMR_HSR1_Xtn Roc Ras AAA_22 KH_4 KAP_NTPase SRP54
Other DBs
NCBI-ProteinID: ACQ48371
LinkDB
Position
complement(4114758..4115663)
AA seq 301 aa
MNRKGYKSGFVSIIGRPNVGKSTFLNRIIGQKIAIMSDKPQTTRNKIQGVYTENDSQVIF
IDTPGIHKPKHKLGDFMVKMAQTTLKEVDIVLFMVNAVEGFGRGEEFIIEKLKETKQPVF
LVINKIDQVHPEQLLELIDQYRKLHDFAEIVPISALDGNNAEALIGTIKKYLPEGPQYYP
DNQVTDHPERFIIAELIREKVLHLTREEVPHSVAVVIDAIQKREGGAVYINATIVVERPS
QKGIIIGKQGKMLKEVGKRARFDIEALLGSKVFLEVWVKVQKDWRNKMSQLRDLGFREDE
Y
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaatagaaaaggttataaatcaggttttgtctctattattggcagaccgaatgttggg
aaatctacatttttaaatcgtattattggtcaaaaaattgctattatgagtgacaagcca
caaacaactcgtaataaaattcaaggcgtatatacagaaaatgattcacaagtaattttc
attgatacaccaggaatacataaacctaaacataaactaggcgacttcatggtgaagatg
gcgcaaacgacattaaaagaagttgatatcgttctgtttatggttaatgctgtcgaaggc
tttggtcgtggtgaagaattcatcattgagaagttaaaagaaacgaaacaaccagtattt
ctagttattaataaaattgaccaagttcacccagaacaattattagagttaattgatcaa
tatcgcaaattacatgactttgcagaaatcgtaccaatttctgcattagacggtaataat
gcggaagctctaattggaacaattaaaaagtatttaccggaaggaccacaatactaccca
gataatcaagtaacggatcatccggagagatttattattgcagagcttattcgtgagaaa
gtactacatttaacacgtgaagaagtgccgcattctgtagctgttgttatcgatgcaatt
caaaaacgcgagggcggagcggtttatatcaatgcaacgattgttgttgaacgtccgtcg
caaaaagggattattatcggaaaacaagggaagatgttaaaagaagtcggtaagcgagct
cgttttgatattgaagcattacttggttctaaagtatttttagaagtatgggtaaaagtg
caaaaagattggcgtaataaaatgtctcagcttcgtgaccttggtttccgcgaagacgag
tattaa

DBGET integrated database retrieval system