KEGG   Bacillus anthracis A0248: BAA_4668Help
Entry
BAA_4668          CDS       T00892                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bai  Bacillus anthracis A0248
Pathway
bai03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bai00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BAA_4668 (ruvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bai03400]
    BAA_4668 (ruvA)
Enzymes [BR:bai01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BAA_4668 (ruvA)
DNA repair and recombination proteins [BR:bai03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BAA_4668 (ruvA)
    RecFOR pathway proteins
     BAA_4668 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C WIYLD 5_3_exonuc PG_binding_2 ADSL_C IMS_HHH
Motif
Other DBs
NCBI-ProteinID: ACQ48866
UniProt: C3P9A8
LinkDB All DBs
Position
complement(4227752..4228369)
Genome map
AA seq 205 aa AA seqDB search
MFEYVTGYVEYVGPEYVVIDHNGIGYQIFTPNPYVFQRSKQEIRVYTYHYVREDIMALYG
FKTREERLLFTKLLGVSGIGPKGALAILASGQTGQVVQAIEHEDEKFLVKFPGVGKKTAR
QMILDLKGKLADVVPDAFVDLFSDEERFDEKKGSSAELDEALEALRALGYAEREVSRVVP
ELLKESLTTDQYIKKALSLLLNGKR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaatatgttacaggttacgtggagtatgtaggaccggaatatgtcgtaattgat
cataatggaattggttatcaaattttcacaccgaatccgtatgtatttcaaagaagtaag
caagaaatccgtgtctatacatatcattatgtgagagaagatattatggcactttacggg
tttaaaacacgtgaagagcgtttattatttacaaagttgttaggggtgtctggtattgga
ccaaaaggtgctcttgcaattttagcttctggtcaaacaggacaggtcgttcaagcgatt
gaacatgaagacgagaagtttttagtgaagttcccgggcgtcggaaagaaaacagcacgc
caaatgattttagatttaaaaggaaaactagcagacgttgtaccagatgcatttgttgat
ttattctcagacgaagaacgttttgatgagaagaaaggttcgtcagctgagcttgatgag
gcgctggaagctctgcgcgcacttggatacgcagaacgagaagtttctcgcgttgtacca
gagttattaaaagaatcattaacgacggatcagtatattaaaaaggcacttagtctttta
ctaaatggtaagaggtga

DBGET integrated database retrieval system