KEGG   Bacillus anthracis A0248: BAA_4768Help
Entry
BAA_4768          CDS       T00892                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00020  Citrate cycle (TCA cycle)
bai00190  Oxidative phosphorylation
bai00650  Butanoate metabolism
bai01100  Metabolic pathways
bai01110  Biosynthesis of secondary metabolites
bai01120  Microbial metabolism in diverse environments
bai01130  Biosynthesis of antibiotics
bai01200  Carbon metabolism
Module
bai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAA_4768 (sdhB)
   00650 Butanoate metabolism
    BAA_4768 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BAA_4768 (sdhB)
Enzymes [BR:bai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BAA_4768 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BAA_4768 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ACQ46135
LinkDB All DBs
Position
complement(4320394..4321155)
Genome map
AA seq 253 aa AA seqDB search
MSEKTIRLIITRQDGPDAQAFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNQTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFIGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacaatccgcctcatcattacgagacaagacggaccagacgcgcaagcg
tttgatcaagagtttgaaattccttatcgtccgaatatgaatattatttcggcgcttatg
gaaattcgccgtaatcctgttgattcaaaaggaaaccaaacgactccgattgcgtgggat
atgaactgtttagaggaagtgtgtggtgcatgttcgatggtgattaacggaaaaccacgt
caatcatgtacagcacttatcgatcaattagagcaaccaattcgcttaaaaccgatgaag
acattcccggttgttcgtgacttacaagttgaccgtagtcgcatgtttaatgctctaaaa
cgtgttaaagcttggattccaattgatggtacgtatgacttaggaccagggccaagaatg
ccagagaagaaacgtcaatgggcttatgagctttcaaaatgtatgacatgtggtgtttgc
ttagaatcatgtccaaacgtaaatagtaaatctgactttattggaccagcaccgttatca
caagctcgtttattcaactcacatccaacgggtgaaatgcataaagcagatcgcttacgt
gcaattatgggtgatggaggacttgcaaactgtggtaactctcaaaactgtgtgcaatca
tgtccaaagggtattccattaacaacttcaattgcggcgttaaaccgtgatacaacaatt
caatcgttcaaagatttctttggtagcgacaataactattaa

DBGET integrated database retrieval system