KEGG   Bacillus anthracis A0248: BAA_4823Help
Entry
BAA_4823          CDS       T00892                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 HlyD HlyD_2 DUF3221
Motif
Other DBs
NCBI-ProteinID: ACQ46387
LinkDB All DBs
Position
complement(4376321..4376974)
Genome map
AA seq 217 aa AA seqDB search
MNQFRRMVIINIITLIVLVGGGIGGYYYYNQAENYLKTDNAKIDGKVIPIASPVAGKLTD
WKAEVGKNYNENDKLGAVTVAAANGEQTVDVTIPQNATVVQSNATTNAFVGAGSPIAYAF
DMNNLWVTANIEETDVDDVQKGQDVDVYVDAYPDTTLTGKVEQVGLTTANTFSMLPSSNA
TANYTKVTQVVPVKISLDHSKSVNIVPGMNVTVRIHK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtttcgaagaatggtgattatcaacattatcacattaattgtactagttggc
ggcggtattggcggttattactattacaatcaagcggaaaattacttaaaaacagacaat
gcaaaaattgatggaaaggtaattccgattgcatcaccagtagcaggtaaattaactgac
tggaaagctgaagtaggtaagaactacaatgagaatgataaattaggtgctgtcactgta
gcagcagcgaatggagaacaaacagtagatgtaacaattccacaaaatgcaacagttgta
caatcaaacgcaacaacaaatgctttcgttggagcaggtagcccgattgcttatgcattt
gatatgaacaatttatgggtaacagcaaatattgaagaaacagatgttgatgatgttcaa
aaaggtcaagatgtagatgtgtatgtagatgcatacccagatacaacgttaacaggaaaa
gtagagcaagtaggcttaacaacagcgaacacattctctatgttgccatcaagcaacgca
acagcgaactatacgaaagtaacacaagtagtaccagttaaaatttctttagatcatagc
aaatcagtaaatattgttcctggcatgaatgtgacagttcgtattcataagtaa

DBGET integrated database retrieval system