KEGG   Bacillus anthracis A0248: BAA_4907Help
Entry
BAA_4907          CDS       T00892                                 

Definition
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00010  Glycolysis / Gluconeogenesis
bai00620  Pyruvate metabolism
bai00630  Glyoxylate and dicarboxylate metabolism
bai00640  Propanoate metabolism
bai00680  Methane metabolism
bai01100  Metabolic pathways
bai01110  Biosynthesis of secondary metabolites
bai01120  Microbial metabolism in diverse environments
bai01130  Biosynthesis of antibiotics
bai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA_4907
   00620 Pyruvate metabolism
    BAA_4907
   00630 Glyoxylate and dicarboxylate metabolism
    BAA_4907
   00640 Propanoate metabolism
    BAA_4907
  09102 Energy metabolism
   00680 Methane metabolism
    BAA_4907
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bai01004]
    BAA_4907
Enzymes [BR:bai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BAA_4907
Lipid biosynthesis proteins [BR:bai01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BAA_4907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACQ47347
LinkDB All DBs
Position
complement(4448176..4449762)
Genome map
AA seq 528 aa AA seqDB search
MKREELLAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAFIK
SGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSY
EPYIGQFDDIEAMESLQKFVLSERSVDGWINLKTALETESDMLEMAKTDKEDMVFLSYTS
GTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGA
TGFVYHGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPL
NREVIETFQKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVDEEGMP
VRVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDD
IIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIP
ILQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagaggaattgttggcaccaccgtcttataatttagtttctgaaatagagaaa
tatacaggtgataaagagaagcttgctttaatttggcaagatgataaagggaatcgacga
gaagttacatacgctgagctaatgaaaggtgcaaataaaattggaaacgcttttataaag
agtggtctgcaaaaaggggacaagctcctcattatgatgccgcgtttaattgaagcgtac
atgacgtatatcgcagcgattaaagcaggatttgtcgtaattccgagttcggaaatgtta
cgcaaaaaggatatcgaatatcgcattggacacggggaagtaaaagcaatcgtaagttat
gagccttacattggacagtttgatgatatagaagcgatggaatcccttcaaaagttcgtt
ctgagcgagcggtcagtagatggatggatcaatttaaaaacagcgttagaaacagaaagt
gacatgttagaaatggcgaagacagataaagaagatatggtctttttatcttacacgtca
ggaacgacaggaaatccaaaaggtgttgttcatacgcatgcgtgggcatacgctcattta
cgtacaagcgctccgaattggctcggaattgaagagaatgatgttgtatgggcaacagct
agtccaggctggcagaagtggatttggagcccgtttttagcaactctaggctcgggggca
acaggatttgtataccacggtaagtttgaaccaaaaacgtatttaaatttattagacgat
aataaggtgaatgtactttgttgtacgccaactgagtatagattaatggcaaaagtagaa
aatttaagcgagtacaatttagaagcgttacatagcgctgtatccgcaggtgagccgtta
aatagagaagtcattgaaacgttccaaaagcactttcatattacagtgagagacggctat
gggcaaacggaaaatacattgcttgttggtgtaatgaaagggatggatattagaccagga
tcaatggggaaaccgacgccaggcaaccacgttgatattgtagatgaggaagggatgcca
gtaagggtaggcgaagttggtgatattgcggttcatattgaaacaccagccctctttaaa
caatactataaagacgatgagcgcacagcgatgcaattccgcggtgattattatattacc
ggtgataaagcaaagaaagatgaagacggctatttctggtttgaagggcgcggtgatgat
attattattagctctggttatacaatcgggccgtttgaagtagaagatgcgctcgtaaag
cacccttatgtaagagaatgtgcggttgtcgcaagtcctgatgaaattcgcggaagtgtc
gtgaaggcatttatcgtattaagagagaatatagaaaagaacgaagaaacattaattcca
atactccaacaacacgtcaaggaacttactgcaccatataaataccctcgcaaaattgaa
tttgtagatgaactaccaaaaacgatttctggaaaaatccgccgtattgaacttagaaaa
caagagatggagattccgtcaaaataa

DBGET integrated database retrieval system