KEGG   Bacillus anthracis A0248: BAA_5758
Entry
BAA_5758          CDS       T00892                                 

Gene name
rpsF
Definition
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
bai  Bacillus anthracis A0248
Pathway
bai03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bai00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BAA_5758 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bai03011]
    BAA_5758 (rpsF)
   03029 Mitochondrial biogenesis [BR:bai03029]
    BAA_5758 (rpsF)
Ribosome [BR:bai03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BAA_5758 (rpsF)
  Bacteria
    BAA_5758 (rpsF)
Mitochondrial biogenesis [BR:bai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAA_5758 (rpsF)
SSDB
Motif
Pfam: Ribosomal_S6 NAS AbiJ_NTD3
Other DBs
NCBI-ProteinID: ACQ49021
UniProt: C3P3E5
LinkDB
Structure
PDB: 
3R3T

Position
complement(5214443..5214733)
AA seq 96 aa
MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY
MILNVNANAEAINEFDRLAKINEDILRHIVVKEEEK
NT seq 291 nt   +upstreamnt  +downstreamnt
atgagaaagtacgaaattatgtacatcattcgtcctggcgttgaagaagaagctcaaaaa
gctttagttgaacgttttgcaggtgttttaacaaacaatggtgcagaaatcattaacacg
aaagagtggggtaagcgtcgtttagcttacgaaatcaacgacttacgtgaaggtttctac
atgatcttaaacgtgaatgctaacgcagaagcaattaacgaattcgatcgtttagctaag
atcaacgaagatatccttcgtcatatcgttgttaaagaagaagaaaaataa

DBGET integrated database retrieval system