KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_150Help
Entry
BCTU_150          CDS       T01528                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
baj00061  Fatty acid biosynthesis
baj00780  Biotin metabolism
baj01100  Metabolic pathways
baj01212  Fatty acid metabolism
Module
baj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:baj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BCTU_150 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BCTU_150 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:baj01004]
    BCTU_150 (fabZ)
Enzymes [BR:baj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BCTU_150 (fabZ)
Lipid biosynthesis proteins [BR:baj01004]
 Fatty acid synthase
  Component type
   BCTU_150 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AEH39739
UniProt: F7WZ85
LinkDB All DBs
Position
183196..183636
Genome map
AA seq 146 aa AA seqDB search
MNDFKTFLNIEKIINFLPHRFLFLLIDQVVKYKKFFLYALKFVSINDFFLGHFPKKFVFP
GVLIIESIAQASGLLSIFSKGQLINKELIYLVSIQNAFFKKQVYPGNKMIIKVFYKKKIN
NFEEFDGIVLVDNTLICKATLLLSRF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattttaaaacttttttaaatattgaaaaaattataaattttttacctcatcgt
ttcctttttttattaattgatcaagttgttaaatacaaaaaattttttttatatgcatta
aaatttgtttcaataaatgacttttttttagggcattttccaaaaaaatttgtttttcct
ggggtattgattattgaatctattgctcaagcaagtggtttattatcaatttttagtaaa
ggacaattaattaataaagaattaatttatttagtaagtatacaaaatgcattttttaaa
aaacaagtatatcctggaaataaaatgattattaaagttttttataaaaaaaaaataaat
aattttgaggaatttgatggaattgttttggttgataatactttaatatgtaaagcgaca
ttattattatctcgtttttaa

DBGET integrated database retrieval system