KEGG   Bacillus cereus biovar anthracis CI: BACI_c41510Help
Entry
BACI_c41510       CDS       T01279                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00061  Fatty acid biosynthesis
bal00620  Pyruvate metabolism
bal00640  Propanoate metabolism
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
bal01130  Biosynthesis of antibiotics
bal01200  Carbon metabolism
bal01212  Fatty acid metabolism
Module
bal_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BACI_c41510 (accC)
   00640 Propanoate metabolism
    BACI_c41510 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BACI_c41510 (accC)
Enzymes [BR:bal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BACI_c41510 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BACI_c41510 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C GARS_A RimK ATP-grasp_3 ATP-grasp_5 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ADK06750
UniProt: D8GVD7
LinkDB All DBs
Position
complement(3931130..3932482)
Genome map
AA seq 450 aa AA seqDB search
MIKKVLIANRGEIAVRIIRACKEMDIETVAIYSEADKESLHVQIADEAYCVGPTISKESY
LNLTNIISVAKLTGCDAIHPGYGFLAENADFAELCRECNLIFIGPSPEAISKMGTKDVAR
DTMKEAGVPIVPGSQGIIKNTEEAIELANQIGYPVIIKATAGGGGKGIRVARHEEELVKG
IQITQQEASTAFGNPGVYLEKYVEDFRHVEIQIMADTHGNAIHLGERDCTIQRRLQKLLE
ESPSPALDENVRKQMGEAAVKAAVAVDYTGAGTVEFIYEYKTKSFYFMEMNTRIQVEHPV
TEMVTGMDLIKEQILVASGEKLSLQQEEVQFNGWAIECRINAENPAKKFMPSPGKVEMYL
PPGGFGIRVDSAVYPGYSIPPFYDSMVAKLIVHGKTREEAIAKMKRALSEFVVEGVHTTI
PFHLQLLDHPDFVKGEFNTKFLEEHELVTQ
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagtattaatagccaatcgtggggaaattgctgtacgaattattcgtgct
tgtaaagaaatggatattgaaacagtcgcaatttattcagaagcagataaagagtcactt
cacgtacaaattgctgatgaggcgtattgtgtaggaccaacgatctcgaaagaaagctat
ttaaatttgacgaacattattagtgttgcgaagttaacaggctgcgatgctattcatcca
ggatacggatttttagctgagaatgcagattttgcagagttatgccgtgaatgtaactta
atttttatcggtccaagtccagaagctatttcaaagatgggcacaaaagacgttgctcgt
gatacaatgaaagaagcaggggttccgattgtaccaggttcacaaggaattattaaaaat
accgaagaagcgattgaacttgctaatcaaattggatatccagttattattaaagcgact
gcaggtggcggcggaaaaggtattcgtgttgcgcgccatgaagaagagcttgtaaaagga
attcaaattacacagcaagaagctagtaccgcttttgggaaccctggtgtatacttagaa
aagtacgttgaagatttccgccatgttgagattcaaataatggcagatacacacggaaat
gccattcatttaggagagcgtgattgtacaattcaacgccgtttgcaaaaactactagaa
gaaagtccatcaccagcacttgatgaaaatgtgcgtaaacagatgggtgaggcggcagtt
aaagcggcggtagcggttgattatacaggtgctggtacggttgagtttatttatgaatat
aaaacgaaaagcttttatttcatggagatgaatacgagaattcaagttgagcatccagtt
actgaaatggtaacagggatggacttaattaaagaacaaattcttgttgcttctggagaa
aagttatcgttacagcaagaagaagtacaatttaatggttgggcaattgaatgccgaatt
aatgcggaaaaccctgccaaaaaatttatgccatctccaggtaaagtagaaatgtacttg
ccaccaggcggatttggtattcgcgtcgattcagctgtatatccgggatattcaatccca
cctttctatgattcgatggttgctaaattaattgttcacggaaaaacacgtgaagaggca
attgcaaaaatgaagcgtgcactcagtgagtttgtcgttgaaggcgtacatacaacaatc
ccgttccatttgcaattgttagatcatcctgattttgtaaaaggtgagtttaatacgaaa
tttttggaagagcatgaacttgtgacgcagtga

DBGET integrated database retrieval system