KEGG   Bacillus cereus biovar anthracis CI: BACI_c45850Help
Entry
BACI_c45850       CDS       T01279                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00020  Citrate cycle (TCA cycle)
bal00480  Glutathione metabolism
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
bal01130  Biosynthesis of antibiotics
bal01200  Carbon metabolism
bal01210  2-Oxocarboxylic acid metabolism
bal01230  Biosynthesis of amino acids
Module
bal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bal_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BACI_c45850 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BACI_c45850 (citC)
Enzymes [BR:bal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BACI_c45850 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADK07170
UniProt: D8GYA6
LinkDB All DBs
Position
complement(4328542..4329834)
Genome map
AA seq 430 aa AA seqDB search
MTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKKIVWKE
VLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDLYVCLR
PVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMGVNKIR
FPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNWGYEVA
EQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFANELIK
NMDVAIIKNA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacaggtgaaaaaattactgtaactaatggtgttatgaatgtaccaaacaatccg
attattccatttatcgaaggagatggaattggtcctgatatttgggcagctgcatctcgt
gtactagaagcagcagttgaaaaagcttatgatggtgagaagaaaatcgtttggaaagaa
gtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggttaccagaagaaacttta
aatttaattcgtgaatatttaatcgcgattaaaggtccacttacaactccagttggcggt
ggtattcgttctctaaacgtagcacttcgtcaagaattagatttatatgtatgtctacgt
ccagttcgttattttgaaggtgttccttcacctgtaaaacgtccggaagatactgatatg
gttattttccgtgaaaatacagaagacatttatgctggaattgaatatgcgcaaggatct
ccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggtgttaataaaatccgc
ttcccagaaacatctggtattggtattaaaccaatctcagaagaagggacaaagcgtctt
gttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttctgttacattagttcat
aaaggaaacattatgaaatttacagaaggtgctttcaaaaactggggttacgaagtagcg
gaacaagaattcggcgacaaagtatttacttgggctgaatatgatcgtatcgttgagaaa
gatggtaaagatgcagcgaataaagcgatggcagacgctgaagtggctggaaaaatcatc
gtaaaagattctattgcagacatcttcttacaacaaattttaactcgtccacgtgagttc
gatgttgttgcaacaatgaacttaaacggtgactacatctctgatgcacttgctgcacaa
gtaggtggaattggtattgcacctggtgcaaacattaactatgtaactggacatgctatc
tttgaagctacgcacggtacagctccaaaatatgcaggtttagataaagtaaacccatct
tcagttcttctttctggtgtattattattagaacacttaggatggaacgaagctgcgaaa
ttagtaactgcttcagttgagaagacaattgcttcaaaagtagtaacttatgatttcgca
cgcttaatggaaggtgcaacagaagtgaaatgttctgagttcgctaatgaacttattaaa
aacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system