KEGG   Bacillus sp. LM 4-2: BsLM_0360Help
Entry
BsLM_0360         CDS       T03908                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
balm  Bacillus sp. LM 4-2
Pathway
balm02020  Two-component system
balm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:balm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BsLM_0360
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BsLM_0360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:balm02035]
    BsLM_0360
Bacterial motility proteins [BR:balm02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BsLM_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal sCache_3_3 Cache_3-Cache_2 sCache_3_2 dCache_3 HAMP EzrA DUF4042 BLOC1_2 Laminin_II RIFIN Tetraspanin MAD DUF4446 DUF3584 Spc7 NPV_P10
Motif
Other DBs
NCBI-ProteinID: AKE22159
LinkDB All DBs
Position
complement(365188..366909)
Genome map
AA seq 573 aa AA seqDB search
MLIKRFKMKLGTKILCLVFVVILLFSASVGTVMLKEITENMKQMATEKAKGDLALSSTYI
DDVMSGDWQVKNNKLYKGQTQINGNEDIVDLLGEKTGDTITIFQGDTRVATNVMKNGERA
VGTQASSEVIAAVLKKGKRFYGQADVAGSSYQTAYMPLKDQNGNIIGMLYTGANQSILAS
LTQSLFTQFAIVLVIVIMVSVILVLVFTRKINKRLNALKSAFESAGNGDMTIEVSDKTGD
ELSELSVYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGAEETNQASEKITEAVQQIAN
GAQDQITRIESSESSLKQASADIRDISANTAAIADKGQLAQSKADIGQKEIANVQAQMDA
IHQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNLLALNAAIEAARAGEQGKGFAVV
ADEVRKLAEESQQSAGQISKLIIEIQNDMNRSARSVEHVKTEAAEGVTMIQRTRDAFKEI
AAATGEISAEISDLSASVTNISASAHHINDSFAANTADIKESTKNTRQAAALTEEQFAAM
EEITAASETLSQLAEELTGIISQFKMINQAENG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgttgataaaacgatttaagatgaagctaggaactaaaattctttgcctcgttttcgtg
gtgattcttttgttttcggcatcagttggcactgtgatgcttaaggaaattacagaaaac
atgaaacaaatggcaactgaaaaagcgaaaggtgatctcgctttaagcagcacttatatt
gatgatgtcatgtcaggcgactggcaggtgaaaaacaataagctctataaagggcaaaca
caaatcaatggaaatgaagatattgttgatctgcttggtgaaaagacaggtgataccatt
accattttccaaggcgatactcgtgttgcaaccaatgtcatgaagaatggcgaaagagct
gtcggcacccaggcttcttctgaagttattgccgctgttttaaagaaaggaaagcgtttt
tacggacaagcagatgtagcaggttcttcttatcagactgcatacatgccgttaaaagat
caaaatggcaacatcatcggcatgctgtataccggagctaatcaaagtattttagcatca
cttacacaatcacttttcactcaattcgctatcgttcttgttatcgtcattatggtatca
gtcatccttgtcttggttttcaccagaaaaatcaacaagcggctgaacgctttaaaaagc
gcctttgaaagtgccggaaacggagatatgacaatagaggtgtcagacaaaaccggtgac
gagctatcagaactaagcgtctattataataagatgagaatgaagctgaacgataccata
caaaccgtacaacaatcagcccttcagcttgcgtcagcctctcagcagctctcagctgga
gcagaggaaacaaatcaagcttcagaaaaaatcacagaagctgtacagcagattgcaaat
ggagcccaagatcaaatcacccgaattgaaagtagtgaaagctcattaaaacaagcttca
gcagacatccgggatatttctgcaaatactgccgctatcgctgacaaagggcagctcgct
caatcaaaagcagacattggacaaaaggaaattgcaaatgtacaggcgcaaatggatgcg
attcaccagtcaattcagaaaagcggagaaatcatacaccagttagacggccgctctaaa
caaattgagcaaattttatcggtcatcacccaaattgccgatcagacaaacctgcttgcg
ctgaatgcagcgattgaagctgccagagccggtgaacaaggaaaaggctttgctgttgtt
gctgatgaagtacggaaattagcagaagagtctcaacagtctgcggggcagatttcaaaa
ctgatcatagaaatacaaaatgatatgaaccggtctgcaagatctgttgagcatgtgaaa
acagaagctgcagaaggggtcaccatgatccagcgcaccagagatgcatttaaggaaatt
gcagctgcaacaggtgaaatcagcgccgagattagtgatttatcagcatctgtaacaaac
atttcagccagtgcacatcatataaatgattcctttgcagccaatacggccgacattaaa
gaatctactaaaaatacccggcaagcggctgcattaacagaggagcaatttgctgcaatg
gaggagattaccgcagcttctgaaacactttctcaattagctgaggagcttaccggtatc
ataagccaatttaaaatgattaatcaagccgaaaacggctga

DBGET integrated database retrieval system