KEGG   Bacillus sp. LM 4-2: BsLM_0454Help
Entry
BsLM_0454         CDS       T03908                                 

Definition
(GenBank) glycosyltransferase
Organism
balm  Bacillus sp. LM 4-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-ProteinID: AKE22253
LinkDB All DBs
Position
474986..476248
Genome map
AA seq 420 aa AA seqDB search
MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNE
EVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGK
GKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKT
LLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSIIEKLGGWDDKALAEDTELT
IRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQYVVLKFLAQFFKLKRKRII
FDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFLFMTEVMITLS
IEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaatacgctgttctttatctcgctaagtttaatatgggttatgcttctctaccac
atgttcctcatgcagggcgggtttcgccactatatgaccttcgaacggaatatcccgaag
tggagagaaaatatgaaggaactgccgaaggtcagcgtcctcatcccggcgcataacgaa
gaggttgtgattcggcagacgctgaaggccatggtcaacctttattatccgaaggaccgg
ctggagattatcgtcgttaatgataattcatcagaccggacgggtgatatcgtcaatgaa
ttttccgagaaatacgatttcatcaaaatggtgattacgaagccgccaaatgcaggaaaa
ggaaaatcctctgcacttaactcgggttttgccgaatcgaacggcgatgtgatctgtgtg
tatgacgccgacaacacgcctgagaaaatggccgtgtattacctcgtgctcggcctgatg
aatgacgaaaaggcaggcgccgtggtagggaaattccgcgtcatcaatgcggcaaagacg
ctgctgacgaggtttattaatatcgaaacgatctgttttcagtggatggcccagggaggc
agatggaagtggttcaaaatcgccacgatcccaggcaccaacttcgcgatccgcagaagc
attatcgaaaagctcggaggctgggatgacaaagcgctcgctgaggatactgagctgacc
atccgggtatataatctcggctatcacatccgctttttccctgccgccatcacgtgggag
caggaaccggaaacatggaaggtatggtggcgccagcgcacccgatgggcgcgcggcaat
caatatgtcgtgctcaaatttttggcgcagttttttaagctgaaacgaaaacggattatc
tttgatttgttttattttttctttacgtacttcctgtttttctttggcgtgatcatgtca
aatgcgatttttgtagtgaatttgttttatgatttgcatttgtctgttggatttttggca
atgattctctggattttggcgtttttcttatttatgacagaggtcatgattacgttgagc
attgaaaaaacagaaatgaacaagcaaaacttttttatcgtatttctcatgtacttcaca
tactcgcaggcatggattgtgcttgttatctactctttattcgtagaaatcaagcaccgt
ttattcaagcaagaggtcaaatggtacaagacagaacgatacaatcaacataaaagcggg
tga

DBGET integrated database retrieval system