KEGG   Bacillus sp. LM 4-2: BsLM_0490Help
Entry
BsLM_0490         CDS       T03908                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
balm  Bacillus sp. LM 4-2
Pathway
balm00473  D-Alanine metabolism
balm01100  Metabolic pathways
balm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:balm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BsLM_0490
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BsLM_0490
Enzymes [BR:balm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BsLM_0490
Peptidoglycan biosynthesis and degradation proteins [BR:balm01011]
 Precursor biosynthesis
  Racemase
   BsLM_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKE22289
UniProt: A0A3Q0MGW9
LinkDB All DBs
Position
509726..510895
Genome map
AA seq 389 aa AA seqDB search
MSTKPFYRDTWAEIDLSAIKENVSNMKKHIGEHVHLMAVVKANAYGHGDAETAKAALDAG
ASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYVAIAAEYDVTLTGYSVEWLQEAARHT
KKGSLHFHLKVDTGMNRLGVKTEEEVQNVMAILDRNPRLKCKGVFTHFATADEKERGYFL
MQFERFKELIAPLPLKNLMVHCANSAAGLRLKKGFFNAVRFGIGMYGLRPSADISDEIPF
QLRPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTVPVGYADGWLRKLKGTDILV
KGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDEYISMDEIAGRLETINYEVACT
ISSRVPRMFLENGSIMEVRNPLLQVNTSN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaacctttttacagagatacgtgggcggaaattgacttgtccgcaataaag
gaaaatgtcagcaatatgaaaaaacatatcggtgaacatgtccacctgatggcagttgtg
aaagcaaacgcctacgggcatggtgatgcagaaacagcaaaggctgctcttgacgcaggt
gcctcatgcctggccgtggccattttggatgaagcgatttcactgcgcaaaaagggattg
aaggcgcctatattggtgcttggcgcggttcccccagagtatgtggcaatcgctgctgag
tatgacgtgaccttaacaggttattctgttgaatggcttcaggaggcagcccgccacacg
aaaaaaggttctcttcattttcatctgaaggtcgatacggggatgaacaggcttggtgta
aaaacagaggaagaagttcagaacgtgatggccattcttgaccgcaaccctcgtttaaag
tgcaaaggggtatttacccattttgcgacagcggatgaaaaagaaagaggctatttctta
atgcagtttgagcgctttaaagagctgattgctccgctgccgttaaagaatctgatggtc
cactgcgcgaacagcgccgccggtctccggctgaaaaaaggcttttttaatgcagtcaga
ttcggcatcggcatgtatggccttcgcccgtctgctgacatttcggacgagataccgttt
cagctgcgtccggcatttaccctgcattcgacgctgtcacatgtcaaactgatcagaaaa
ggcgagagcgtcagctacggagccgagtacacagcagaaaaagacacatggatcgggacg
gtgcctgtaggctatgcggacggctggctccgaaaattgaaagggactgacatccttgtg
aagggaaaacgcttgaaaattgccggccgaatttgcatggaccaatttatggtggagctg
gatcaggaatatccgccgggcacaaaagttacattaataggccggcagggggatgaatat
atttccatggatgagattgcaggaaggctcgaaaccattaactacgaagtggcctgtaca
ataagttcccgtgttccccgtatgtttttggaaaatgggagtataatggaagtaagaaat
cctttattgcaggtaaatacaagcaattaa

DBGET integrated database retrieval system