KEGG   Bacillus sp. LM 4-2: BsLM_0842Help
Entry
BsLM_0842         CDS       T03908                                 

Definition
(GenBank) acetoin dehydrogenase E1 component (TPP-dependent alpha subunit)
  KO
K21416  acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha [EC:1.1.1.-]
Organism
balm  Bacillus sp. LM 4-2
Brite
KEGG Orthology (KO) [BR:balm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BsLM_0842
Enzymes [BR:balm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BsLM_0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N ECH_1
Motif
Other DBs
NCBI-ProteinID: AKE22641
LinkDB All DBs
Position
854575..855576
Genome map
AA seq 333 aa AA seqDB search
MELLKREGLSLTEEKALWMYQKMLEIRGFEDKVHDLFAQGVLPGFVHLYAGEEAVAVGVC
AHLHDGDSITSTHRGHGHCIAKGCDLDGMMAEIFGKATGLCKGKGGSMHIADLDKGMLGA
NGIVGGGFTLACGSALTAKYKQTKNVSVCFFGDGANNQGTFHEGLNLAAVWNLPVVFVAE
NNGYGEATPFEYASACDSIADRAAAYNMPGVTVDGKDILAVYQAAEEAIERARNGGGPSL
IECMTYRNYGHFEGDAQTYKTKDERVEHLEEKDAIQGFKNYLLKETDANKLSDIEQRVSE
SIEKAVSFSEDSPYPKDSELLTDVYVSYEKGGM
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaattgttaaaacgagagggcttgtcattaactgaggaaaaagcgctgtggatgtac
caaaagatgctggagatcaggggctttgaagacaaagtgcatgacctgttcgcccaggga
gtgcttcccggattcgttcatttatatgccggtgaggaagccgtggctgtaggggtgtgc
gctcatttacatgatggcgacagcattacaagcacccacaggggacatggacattgtatc
gccaaaggctgtgacctggacggcatgatggcggaaattttcgggaaagcgaccggattg
tgcaaaggcaagggcggttctatgcacattgcggatcttgataaaggcatgttaggcgca
aatggaatcgtcgggggcggctttacgctcgcatgcggatcagcgctcacggctaaatat
aaacagactaaaaatgtaagcgtttgctttttcggggacggggcaaataaccaaggcacc
ttccacgaagggctgaatttagcggctgtatggaaccttcctgtcgtatttgttgctgaa
aacaacggctatggcgaagctaccccatttgagtacgcatcagcctgcgattcaatcgcc
gatcgggcggctgcttataacatgccgggggtgacagttgacggcaaagatattttagca
gtttaccaggcagccgaggaagcgatagaaagagcaagaaacggcggcggcccgtctttg
attgaatgtatgacctacagaaactacggccatttcgaaggagatgcccaaacctataaa
acgaaggatgaaagagttgagcaccttgaagaaaaagatgccattcaaggttttaaaaac
taccttttaaaagaaacagatgctaataagctgtcagacattgaacagcgtgtcagcgaa
tcgattgaaaaagccgtctcgttcagcgaagacagcccatatccaaaagattcggagctg
ctgacagatgtgtacgtgtcatatgaaaaaggaggaatgtaa

DBGET integrated database retrieval system