KEGG   Bacillus sp. LM 4-2: BsLM_1170Help
Entry
BsLM_1170         CDS       T03908                                 

Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
balm  Bacillus sp. LM 4-2
Pathway
balm00220  Arginine biosynthesis
balm01100  Metabolic pathways
balm01110  Biosynthesis of secondary metabolites
balm01130  Biosynthesis of antibiotics
balm01210  2-Oxocarboxylic acid metabolism
balm01230  Biosynthesis of amino acids
Module
balm_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:balm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BsLM_1170
Enzymes [BR:balm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     BsLM_1170
    2.3.1.35  glutamate N-acetyltransferase
     BsLM_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AKE22969
LinkDB All DBs
Position
1173030..1174310
Genome map
AA seq 426 aa AA seqDB search
MKKLDSPSRQFIHRTGENRTMIQLSEDQIVKVTGDVSSPKGFQAKGVHCGLRYSKKDLGV
IISETPAVSAAVYTQSHFQAAPIKVTQDSLKHGPTLIAVIVNSAIANACTGEQGLKDAYT
MRESFASQLGIEPELVAVSSTGVIGEHLDMEKIHAGIELLKETPAGSGDFEEAILTTDTV
IKQTCYELAIGGKTVTIGGAAKGSGMIHPNMATMLGFVTTDAAIEEKALQKALREITDVS
FNQITVDGETSTNDMVLVMANGCAENECLTEDHPDWPVFKKALLLTCEDLAKEIARDGEG
ATKLIEAQVQGAKNNLDANVIAKKIVGSNLVKTAVYGTDANWGRIIGAIGHSAAQVTAEE
VEVYLGGQCLFKNNEPQPFSESIAKEYLEGDEITIVIKMDEGDGNGRAWGCDLTYDYIKI
NASYRT
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactggactcaccatcacgccaatttatccatagaacgggagagaatcgaacc
atgattcagttaagtgaagatcaaattgtaaaagtaacaggtgatgtatcctcaccaaaa
ggatttcaggcaaagggtgtgcattgcgggctgcgttactcaaaaaaagacctcggcgtc
attatcagcgagacaccggccgtgagcgcagcggtttatacccaaagccactttcaggct
gctccgatcaaagtgacacaagacagcttaaagcacggaccgacactgatagccgtcatc
gtcaacagcgccattgccaacgcctgcacgggagaacagggcttaaaggacgcatacaca
atgcgggagagctttgcttcacagcttggcattgagccggagcttgtcgctgtttcatca
acgggtgtcatcggcgagcatttagacatggaaaaaatccacgcggggatcgagctgctg
aaagaaacacctgcgggatcaggcgattttgaggaagcgatcttaacaacagatacggtg
attaagcagacgtgctatgagctggcaatcggcggcaaaacagtcacgatcggcggagcg
gccaaaggctcagggatgatacatccgaacatggccacgatgctgggatttgtgacaact
gacgcggcaattgaagaaaaagcgctgcaaaaggcgcttcgggaaatcactgacgtttca
tttaaccaaatcacagttgacggagaaacatccacgaacgatatggtattagttatggcg
aatggctgcgccgaaaacgagtgcctgacagaagaccatccagactggccggtctttaaa
aaagcgctcttgctcacttgtgaggatctggctaaagagattgccagagacggagaaggc
gcgacaaaactaattgaagcccaagtgcagggagcgaaaaacaatcttgatgcaaacgtc
attgccaaaaagattgtcggctcaaatcttgtaaaaacggcagtatacggaacagatgcc
aactgggggcggatcatcggagccatcggacactccgcagcacaggtgacggcagaagaa
gtagaggtttatcttggcggccaatgcctgtttaagaataacgaacctcagccattctct
gaatctatcgccaaggaataccttgaaggagatgaaatcaccattgtcatcaagatggat
gaaggggacggaaacgggagagcgtggggctgtgacctgacctatgactatatcaaaatt
aacgcgagctatcgcacgtaa

DBGET integrated database retrieval system