KEGG   Bacillus sp. LM 4-2: BsLM_2553Help
Entry
BsLM_2553         CDS       T03908                                 

Definition
(GenBank) hypothetical protein
Organism
balm  Bacillus sp. LM 4-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_XkdX ATP-cone
Motif
Other DBs
NCBI-ProteinID: AKE24351
LinkDB All DBs
Position
complement(2511271..2511435)
Genome map
AA seq 54 aa AA seqDB search
MNYWVLALHYNWASSEMVKKAIHYKDCSTEDLQKGVEKKLITAEQYKEITGEAI
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgaattattgggtgctggctttgcattataactgggcttcttctgaaatggtgaaaaag
gcaatccattataaagattgctcgactgaggatttacaaaaaggggtagagaaaaaactc
attacagctgaacagtataaagagatcacaggagaagccatttag

DBGET integrated database retrieval system