KEGG   Bacillus sp. LM 4-2: BsLM_2658
Entry
BsLM_2658         CDS       T03908                                 

Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIC component
  KO
K11196  fructose PTS system EIIC component
Organism
balm  Bacillus sp. LM 4-2
Pathway
balm00051  Fructose and mannose metabolism
balm02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:balm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BsLM_2658
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BsLM_2658
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:balm02000]
    BsLM_2658
Transporters [BR:balm02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BsLM_2658
SSDB
Motif
Pfam: EII-Sor TMEM251
Other DBs
NCBI-ProteinID: AKE24456
LinkDB
Position
complement(2600966..2601775)
AA seq 269 aa
MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIH
RADQYAKAGNIKGIEIMHITAMVFQALRVMIPTLIVALISVSAVQAFLGNIPDVITKGLQ
IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ
KQSAHGAVAAASDSGSVAVYDDDDDDLDA
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtcttcattacaaattattttgttgttaatcattgcagcaatcaccggaatcgcaagt
gtattggatgaagggcagacacaccggccgctagtggcctgtacgttggttggcttggtg
ctcggggacttaaaaacgggaattattcttggaggcacactggagctgatggcgctcggc
tggatgaacgtcgggcttgccatggcacctgatacagcgatcgcctctgtcatctcaacc
attttagttattaccgctgatcaaggaattggcgaagggattgctgtcgctgttgcttta
gcagctgcgggtcaggcgctgacgatttttgttcggacgatcactgtctttttcatccac
cgcgctgatcaatatgcaaaagcgggaaatataaaaggaattgaaattatgcatattacc
gcgatggtgtttcaagctttgcgcgtcatgattcctacattgattgttgctttaattagt
gtcagcgctgttcaggcgttcctgggaaatattcctgatgtcattacaaaaggactgcaa
ataggcggaggcattattgtggttgtcgggtatgccatggtgatcaatatgatgaatatt
ccttatttaaagccatttttctatattggtttcttattagcggcgtttaccgattttaac
ttagtgggatttggagcccttggtctctgtctggcgcttttataccagcaggtgatgcaa
aaacaaagcgctcacggagcagtcgcggccgcatcagacagtggcagtgttgctgtttat
gatgacgatgatgatgatcttgatgcctaa

DBGET integrated database retrieval system