KEGG   Bacillus sp. LM 4-2: BsLM_3292Help
Entry
BsLM_3292         CDS       T03908                                 

Definition
(GenBank) hypothetical protein
Organism
balm  Bacillus sp. LM 4-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tautomerase_2 Tautomerase DUF1007
Motif
Other DBs
NCBI-ProteinID: AKE25089
LinkDB All DBs
Position
complement(3232600..3232983)
Genome map
AA seq 127 aa AA seqDB search
MPFVQIHLRSGRSEAWLQKLSRTVHQSMIEEINVPEDDYFQVIRQYEKSEFFYDPFYLQV
ERTDELIYIHFTLKQSRTTEQKKALYRSIASRIHSELGVRKEDVFIMLAGNQAEDWSFGN
GRAQMIE
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgtacagattcatttacggtcgggaagaagcgaagcgtggcttcaaaaactg
agcaggactgtccaccaatcgatgattgaagaaatcaatgtgccggaagatgactatttc
caagtcatcagacaatatgaaaaaagcgaatttttttatgatccattttatctccaagtc
gagcgaactgatgaactgatatacattcattttacactgaaacagtcaagaacaactgaa
cagaaaaaagcactttaccgctcaatcgcgagccggattcattccgagcttggcgtcaga
aaagaagatgtgtttatcatgctggccggaaatcaggctgaggattggtctttcggaaat
ggaagagcccagatgattgaataa

DBGET integrated database retrieval system