KEGG   Bacillus sp. LM 4-2: BsLM_3561Help
Entry
BsLM_3561         CDS       T03908                                 

Definition
(GenBank) membrane bound transcriptional regulator
Organism
balm  Bacillus sp. LM 4-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr DUF4840 ETRAMP
Motif
Other DBs
NCBI-ProteinID: AKE25358
LinkDB All DBs
Position
3497977..3499152
Genome map
AA seq 391 aa AA seqDB search
MAERVRVRVRKKKKSKRRKILKRIMLLFALALLVVVGLGGYKLYKTINAADESYDALSRG
NKSNLRNEVVDMKKKPFSILFMGIEDYATKGQKGRSDSLIVVTLDPKNKTMKMLSIPRDT
RVQLAGDTTGSKTKINAAYSKGGKDETVETVENFLQIPIDKYVTVDFDGFKDVINEVGGI
DVDVPFDFDEKSDVDESKRIYFKKGEMHLNGEEALAYARMRKQDKRGDFGRNDRQKQILN
ALIDRMSSASNIAKIDKIAEKASENVETNIRITEGLALQQIYSGFTSKKIDTLSITGSDL
YLGPNNTYYFEPDATNLEKVRKTLQEHLDYTPDTSTGTSGTEDGTDSSSSSGSTGSTGTT
TDGTTNGSSYSNDSSTSSNNSTTNSTTDSSY
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgcgttagagtgcgtgtgcgaaaaaagaaaaagagcaaacgtaggaaaatt
ttaaaaagaataatgttattgttcgcccttgcactattggtagttgtagggcttggcggg
tataaactttataaaaccattaacgctgcggatgaatcgtacgatgccctatcccgcggg
aataaatcaaatcttcgcaacgaagttgtagacatgaagaaaaaaccattttctatttta
tttatgggaatagaggattacgcgactaaaggacaaaaagggagatcagactctcttatt
gttgttaccctggatcccaaaaataaaaccatgaaaatgctgagcattccgcgtgacaca
cgtgtgcaattagctggtgacacaacgggaagcaagacgaagatcaatgccgcttacagc
aaaggcggtaaagatgaaacagttgaaactgttgaaaacttcttgcaaatcccgatcgat
aaatatgtcacagttgattttgacggatttaaagatgtgattaatgaagtcggcggtatt
gatgttgacgtgcctttcgatttcgatgaaaaaagtgatgtagacgaaagcaaacggatt
tacttcaaaaaaggcgagatgcatttgaacggcgaagaagccttagcatatgcccggatg
agaaaacaggataaacgcggagactttggccgtaatgacagacaaaaacaaatcttaaac
gcgctgattgaccgcatgtcaagtgcaagcaacattgctaaaattgataaaatcgcagaa
aaagccagcgaaaacgttgaaaccaatattcgcattactgaaggtttagcgcttcagcag
atttacagcggctttaccagcaaaaaaatcgacacattgagcattacaggttctgatttg
tatttagggcctaacaacacatattactttgaacctgatgctacaaatctcgagaaagtc
agaaaaacgcttcaagagcatttagattatactcctgatacaagcactggcacttccggt
accgaagacgggactgacagctcaagcagttctggcagcactggcagcactggcacaaca
actgacgggacgacgaacggaagcagctattcgaatgacagcagcacaagctcaaacaac
agtacaacgaattcaacaactgattcatcctattaa

DBGET integrated database retrieval system