KEGG   Bacillus sp. LM 4-2: BsLM_3622Help
Entry
BsLM_3622         CDS       T03908                                 

Definition
(GenBank) spore coat protein (outer)
  KO
K06325  spore coat protein B
Organism
balm  Bacillus sp. LM 4-2
Brite
KEGG Orthology (KO) [BR:balm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BsLM_3622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2642
Motif
Other DBs
NCBI-ProteinID: AKE25419
LinkDB All DBs
Position
complement(3566203..3567426)
Genome map
AA seq 407 aa AA seqDB search
MSKRRMKYHSNNEISYYNFLHSMKDKIVTVYRGGPESKKGKLTAVKSDYIALQAEKKIIY
YQLEHVKSITEDTNNSTTTIETEEMLDADDFHSLIGHLINQSVQFNQGGPESKKGRLVWL
GDDYAALNTNEDGVVYFNIHHIKSISKHEPDLKIEEQTPVGVLEADDLSEVFKSLTHKWV
SINRGGPEAIEGILVDNADGHYTIVKNQEVLRIYPFHIKSISLGPKGSYKKEDQKNEQSQ
EDNNDKDSNSFISSKSYSSSKSSKRSLKSSDDQSSKSGRSSRSKSSSKSSKRSLKSSDYQ
SSKSGRSSRSKSSSKSSKRSLKSSDYQSSKSGRSSRSKSSSKSSKRSLKSSDYQSSKSSK
RSPRSSDYQSSRSPGYSSSFKSSEKQKDDYSYETIVRTIDYHWKRKF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaggagaatgaaatatcattcaaataatgaaatatcgtattataactttttg
cactcaatgaaagataaaattgttactgtatatcgtggaggtccggaatctaaaaaagga
aaattaacagctgtaaaatcagattatatagctttacaagctgaaaaaaaaataatttat
tatcagttggagcatgtgaaaagtattactgaggataccaataatagcaccacgacaatt
gagactgaggaaatgctcgatgctgatgattttcatagcttaatcggacatttaataaac
caatcagttcaatttaaccaagggggtccggaatctaaaaaaggaagattggtctggctg
ggagatgattacgctgcgttaaacacaaatgaggatggggtagtgtattttaatatccat
cacatcaaaagtataagtaaacacgagcctgatttgaaaatagaagagcagacgccagtt
ggagttttggaagctgatgatttaagcgaggtttttaagagtctgactcataaatgggtt
tcaattaatcgtggaggtccggaagccattgagggtatccttgtagataatgccgacggc
cattatactatagtgaaaaatcaagaggtgcttcgcatctatccttttcacataaaaagc
atcagcttaggaccaaaagggtcgtacaaaaaagaggatcaaaaaaatgaacaaagccag
gaagacaataatgataaggacagcaattcgttcatttcttcaaaatcatatagctcatca
aaatcatctaaacgatcactaaaatcttcagatgatcaatcatccaaatctggtcgttcg
tcacgttcaaaaagttcttcaaaatcatctaaacgatcactaaaatcttcggattatcaa
tcatccaaatctggccgttcgtcacgttcaaaaagttcttcaaaatcatctaaacgatca
ctaaaatcttcggattatcaatcatccaaatctggccgttcgtcacgttcaaaaagttct
tcaaaatcatctaaacgatcattaaaatcttcagattatcaatcatcaaaatcatctaaa
cgatcaccaagatcatcagattatcaatcatcaagatcaccaggttattcaagttccttc
aaaagttcagaaaaacaaaaggatgattatagctatgaaacgattgtcagaacgatagac
tatcactggaaacgtaaattttaa

DBGET integrated database retrieval system